Loading...
HomeMy WebLinkAboutFA-11_2509_CA_AFVR_20231206_RW-2 3502 Hayes Road • Monroe, North Carolina 28110 113 West Firetower Road, Suite G • Winterville, North Carolina 28590 Phone (704) 845-4010 • (888) 870-4133 • Fax (704) 845-4012 December 6, 2023 Mr. Corey Futral NCDEQ-UST Section Wilmington Regional Office 127 Cardinal Drive Extension Wilmington, NC 28405 Re: Free Product Recovery November 14, 15 & 16 2023 Shields Exxon 100 North Sandhills Boulevard Aberdeen, Moore County North Carolina Facility ID Number: 00-0-0000020676 Incident Number: 2509 GRI Project Number: 3913 Dear Mr. Futral, Please find enclosed the referenced report for the abovementioned site. If you have any questions, please contact William Regenthal at 704-845-4010. Sincerely, Geological Resources, Inc. Leslie Maxtone-Graham Administrative Assistant Enclosure Cc: Mr. Frank McNeill; McNeill Oil Company, Inc., file 3502 Hayes Road • Monroe, North Carolina 28110 113 West Firetower Road, Suite G • Winterville, North Carolina 28590 Phone (704) 845-4010 • (888) 870-4133 • Fax (704) 845-4012 Free Product Recovery Report – November 15, 2023 Shields Exxon 100 North Sandhills Boulevard Aberdeen, Moore County North Carolina Facility ID Number: 00-0-0000020676 Incident Number: 2509 GRI Project Number: 3913 Prepared for: Mr. Frank McNeill McNeill Oil Company, Inc. Post Office Box 396 Aberdeen, North Carolina 28315 December 5, 2023 William L. Regenthal, P. G. Project Manager Asher Knobel Report Writer ___________________________________________________________________________________________ Prepared by: Geological Resources, Inc. Free Product Recovery Report – November 15, 2023 Prepared on: December 5, 2023 Shields Exxon Project Manager: William L. Regenthal, P. G. GRI Project No. 3913 i SITE INFORMATION 1. Site Identification  Shields Exxon (Facility ID 00-0-0000020676)  Incident Number 2509 – Intermediate Risk (I170D)  Location of Source Area: 100 North Sandhills Boulevard Aberdeen, NC 28314 Moore County 35.133448° N / 79.428249° W (Topographical Map) 2. Information about Contacts Associated with the Leaking UST System UST Owner McNeill Oil Company, Inc. P.O. Box 369 Aberdeen, NC 28315 910-944-2329 fmcneill@mcneilloilandpropane.com UST Operator McNeill Oil Company, Inc. P.O. Box 369 Aberdeen, NC 28315 910-944-2329 fmcneill@mcneilloilandpropane.com Property Owner MC, B, MC, LLC P.O. Box 369 Aberdeen, NC 28315 910-944-2329 fmcneill@mcneilloilandpropane.com Property Occupant Gary’s Service Center, Inc. 100 N Sandhills Blvd. Aberdeen, NC 28315 910-944-5942 Consultant/Contractor Geological Resources, Inc. 3502 Hayes Road Monroe, NC 28110 704-845-4010 wlr@geologicalresourcesinc.com AFVR Contractor/Operator Eastern Environmental Management LLC. P.O. Box 4030 Rocky Mount, NC 27803 252-443-2224 3. Information about Release  Release was discovered on March 11, 1975.  Approximately 30,000 gallons of product was released from the leaking UST System.  Three 4,000-gallon gasoline and two 2,000-gallon gasoline USTs, associated dispensers and product piping were removed from the site on May 16, 2000. ___________________________________________________________________________________________ Prepared by: Geological Resources, Inc. Free Product Recovery Report – November 15, 2023 Prepared on: December 5, 2023 Shields Exxon Project Manager: William L. Regenthal, P. G. GRI Project No. 3913 ii EXECUTIVE SUMMARY Shields Exxon is located at 100 North Sandhills Boulevard in Aberdeen, Moore County, North Carolina. The site is currently owned by MC, B, MC, LLC and operates as an automotive repair shop. A release was discovered at the site in March 1975. On May 16, 2000, three 4,000-gallon gasoline and two 2,000-gallon gasoline USTs were removed from the site. The adjoining properties are a mixture of general commercial and residential properties. According to the information determined during receptor survey activities, no water supply wells were identified within a 1,000-foot radius of the source area. Aberdeen Creek was identified within a 500-foot radius of the source area. Public water is available to the site and surrounding properties within a 1,500-foot radius of the site. On November 15, 2023, an AFVR event was conducted at the site on RW-2. A total of 482 gallons of affected ground water was recovered during the AFVR event. No measurable liquid free product was recovered during this AFVR event. The average liquid recovery rate was 60.25 gallons per hour. A total of 4.09 gallons of vapor phase free product was removed during the event at a rate of 0.51 gallons per hour. The site is intermediate risk due to the presence of free product and contaminant concentrations above GCLs. Free product needs to be removed and contaminant concentrations will need to be less than the 10 X 2B standards for the incident to be re-classified as low risk. Based on this information, GRI recommends that free product removal should continue at the site until free product is no longer present. Groundwater sampling at the site should occur within 30 days to determine the results of the November 2023 AFVR event. Additional quarterly ground water sampling events should be conducted to establish contaminant trends for the site while the feasibility of corrective action options is discussed. ___________________________________________________________________________________________ Prepared by: Geological Resources, Inc. Free Product Recovery Report – November 15, 2023 Prepared on: December 5, 2023 Shields Exxon Project Manager: William L. Regenthal, P. G. GRI Project No. 3913 iii ACRONYMS ACM: Asbestos Containing Materials AFVR: Aggressive Fluid-Vapor Recovery ARR: Acknowledgement of Report Receipt AS: Air Sparging AST: Aboveground Storage Tank ASTM: American Society for Testing and Materials BGS: Below Ground Surface CAP: Corrective Action Plan CFR: Code of Federal Regulations CSA: Comprehensive Site Assessment DPE: Dual Phase Extraction DRO: Total Petroleum Hydrocarbons Diesel Range Organics DWM: Division of Waste Management DWR: Department of Water Resources EPA: Environmental Protection Agency EPH: Extractible Petroleum Hydrocarbons ESA: Environmental Site Assessment GCL: Gross Contamination Level GRI: Geological Resources, Inc. GRO: Total Petroleum Hydrocarbons Gasoline Range Organics HERR: Hazmat Emergency Response and Remediation LSA: Limited Site Assessment MAC: Maximum Allowable Concentration as specified in T15A NCAC 2L.0202 MADEP: Massachusetts Department of Environmental Protection MCC: Maximum Contaminant Concentrations MMPE: Mobile Multi-Phase Extraction NAPL: Non-Aqueous Phase Liquid, “Free Product” NCDEQ: North Carolina Department of Environmental Quality NCDOT: North Carolina Department of Transportation NFA: Notice of No Further Action NORR: Notice of Regulatory Requirements NOV: Notice of Violation NPDES: National Pollutant Discharge Elimination System NRP: Notice of Residual Petroleum O&M: Operation and Maintenance PAHs: Polynuclear Aromatic Hydrocarbons PCA: Pre-Construction Assessment RAL: Regulatory Action Level SCLs: Soil Cleanup Level SPCC: Spill Prevention Control and Countermeasures SVE: Soil Vapor Extraction SVOCs: Semi-Volatile Organic Compounds SWPPP: Stormwater Pollution Prevention Plan TCLP: Toxicity Characteristic Leaching Procedure (EPA Method SW-846 1311) TOC: Top of Casing TPH: Total Petroleum Hydrocarbons USGS: United States Geological Survey UST: Underground Storage Tank UVF: Ultraviolet Fluorescence VOCs: Volatile Organic Compounds VPH: Volatile Petroleum Hydrocarbons ___________________________________________________________________________________________ Prepared by: Geological Resources, Inc. Free Product Recovery Report – November 15, 2023 Prepared on: December 5, 2023 Shields Exxon Project Manager: William L. Regenthal, P. G. GRI Project No. 3913 TABLE OF CONTENTS SITE INFORMATION ............................................................................................................................ i EXECUTIVE SUMMARY ....................................................................................................................... ii ACRONYMS ....................................................................................................................................... iii 1.0 SITE HISTORY AND CHARACTERIZATION ...................................................................................1 2.0 PRESENTATION OF CURRENT SITE ASSESSMENT INFORMATION/ COMPARISON TO HISTORICAL ASSESSMENT INFORMATION ...................................................................................................2 3.0 FREE PRODUCT REMOVAL ........................................................................................................3 4.0 AFVR EVENT ............................................................................................................................3 5.0 PROPOSED REMEDIAL OPTIONS ...............................................................................................4 6.0 CONCLUSIONS .........................................................................................................................4 7.0 LIMITATIONS ...........................................................................................................................4 8.0 STATEMENTS AND CERTIFICATION ...........................................................................................5 FIGURES Figure 1: Site Location Map Figure 2: Site Map Figure 3: Site Vicinity Map TABLES Table 1: UST Owner and Operator Information Table 2: UST System Information Table 3: Adjacent Property Owner Information Table 4: Well Construction and Gauging Information Table 5: Free Product Recovery Results Table 6: Free Product Recovery Event Information Table 7: Free Product Recovery Cost Summary APPENDICES Appendix A: State Correspondence Appendix B: Historical Soil Quality Information and Cross Section Maps Appendix C: AFVR Data and Calculations Appendix D: Liquid Disposal Manifest ___________________________________________________________________________________________ Prepared by: Geological Resources, Inc. Free Product Recovery Report – November 15, 2023 Prepared on: December 5, 2023 Shields Exxon Project Manager: William L. Regenthal, P. G. GRI Project No. 3913 1 1.0 SITE HISTORY AND CHARACTERIZATION GRI presents the results of the November 15, 2023 AFVR event at the Shields Exxon site located at 100 North Sandhills Boulevard in Aberdeen, Moore County, North Carolina (Figure 1). These activities were conducted in accordance with GRI Proposal No. 23-664, which was submitted to NCDEQ on October 12, 2023, and was approved as Task Authorization No. 2509-13 on October 17, 2023. State correspondence has been included as Appendix A. The site is currently owned by MC, B, MC, LLC and currently operates as an automotive repair shop. On May 16, 2000, three 4,000-gallon gasoline and two 2,000-gallon gasoline USTs, associated dispensers and product piping were removed. A release was discovered in March 1975. UST owner/operator information and UST system information are included as Tables 1 and 2, respectively. The Registered Tank Report is shown below: The site and surrounding area are a mixture of general commercial and residential properties. The site contains one building and is primarily capped with concrete and asphalt. The overall topography at the site is relatively flat. Seventeen Type II monitoring wells (MW-1 through MW-17), one Type III monitoring well (TW-1) and five recovery wells (RW-1 through RW-5) were installed at the site during previous ground water assessment activities. Please note, MW-1 and MW-5 have not been located during past assessment activities and are assumed to have been destroyed. A Site Map showing the locations of the monitoring wells and the structures on-site has been included as Figure 2. On September 10, 2015, GRI personnel conducted a receptor survey at the site. No water supply wells were identified within a 1,000-foot radius of the source area. Aberdeen Creek was identified within 500- feet of the contaminant source area. Municipal water is available to the site and surrounding properties. Adjacent property owner information is presented in Table 3. A Site Vicinity Map showing the location of Aberdeen Creek and adjacent properties has been included as Figure 3. ___________________________________________________________________________________________ Prepared by: Geological Resources, Inc. Free Product Recovery Report – November 15, 2023 Prepared on: December 5, 2023 Shields Exxon Project Manager: William L. Regenthal, P. G. GRI Project No. 3913 2 Between December 2019 and September 2020, twenty-two soil borings were installed at the site in order to delineate the free product and gross contamination plumes. On September 6, 2023, free product removal via hand bailing was conducted on RW-1 and RW-4. Approximately 0.25 gallons and 0.75 gallons of free product were removed from RW-1 and RW-4, respectively. A total of 1.35 gallons of liquid was recovered and stored in a 55-gallon drum that had been staged on site. A 2-inch absorbent boom and a 4-inch absorbent boom were installed in RW-1 and RW-4, respectively, upon completion of hand bailing. On November 14, 2023, an AFVR event was conducted in RW-1 and 526 gallons of liquid was recovered as well as 3.95 gallons of product were recovered. Refer to previous reports for additional information. 2.0 PRESENTATION OF CURRENT SITE ASSESSMENT INFORMATION/ COMPARISON TO HISTORICAL ASSESSMENT INFORMATION Soil assessment was not conducted during the current scope of work. Historical soil quality information and cross section maps have been included as Appendix B. On November 15, 2023, an AFVR event was conducted at the site on RW-2. A total of 482 gallons of affected ground water was recovered during the AFVR event. Three Type II monitoring wells (MW-3, MW- 6, and MW-7) were used as observation wells during the event. No free product was observed in the extraction and observation wells during this event. Depths to ground water in the Type II monitoring wells ranged from 7.72 feet to 8.32 feet below the tops of well casings at the start of the event, and 7.73 to 8.31 at the conclusion of the event. Well construction and gauging information is presented in Table 4. A summary of the current ground water gauging data for the AFVR event is shown below: Well ID Screened Interval (x to y ft. BGS) Bottom of Well (ft. BGS) Top of Casing Elevation (ft.) Depth to Water from Top of Casing (feet) Free Product Thickness (ft.) Ground Water Elevation (ft.) MW-3 Before AFVR 2.3-12.3 12.3 99.20 8.32 --- 90.88 MW-3 After AFVR 2.3-12.3 12.3 99.20 8.31 --- 90.89 MW-6 Before AFVR 3-13 13 99.37 8.24 --- 91.13 MW-6 After AFVR 3-13 13 99.37 8.31 --- 91.06 MW-7 Before AFVR 2-12 12 98.87 7.72 --- 91.15 MW-7 After AFVR 2-12 12 98.87 7.73 --- 91.14 RW-2 Before AFVR 3-13 13 100.32 8.10 --- 92.22 RW-2 After AFVR 3-13 13 100.32 8.09 --- 92.23 ___________________________________________________________________________________________ Prepared by: Geological Resources, Inc. Free Product Recovery Report – November 15, 2023 Prepared on: December 5, 2023 Shields Exxon Project Manager: William L. Regenthal, P. G. GRI Project No. 3913 3 Groundwater samples were not collected during this event. Since free product continues to be present at the site, the baseline contaminant mass at the site has not been established. The site is located in the Coastal Plain Physiographic Province of North Carolina. The seasonal high depth to water is approximately 7 to 8 feet BGS. 3.0 FREE PRODUCT REMOVAL In February 2022, a hand bailing event was conducted in MW-8 and RW-1 and 14.5 gallons of liquid were recovered. From August 1, 2022, through August 5, 2022, a MMPE event was conducted on MW-8, RW-1, RW-2, and RW-4. A total of 1,500 gallons of liquid were recovered as well as 1.63 gallons of product were recovered. In September 2023, a hand bailing event was conducted in RW-1 and RW-4. A total of 1.35 gallons of liquid (product/water mix) was removed. Subsequently, one 2-inch absorbent boom was installed in RW- 1, and a 4-inch absorbent boom was installed in RW-4. On November 14, 2023, an AFVR event was conducted in RW-1. A total of 526 gallons of liquid was recovered as well as 3.95 gallons of product were recovered. 4.0 AFVR EVENT An AFVR event was conducted at the site by Eastern Environmental Management, under the supervision of GRI on November 15, 2023. Recovery well RW-2 was used as the extraction well during the event. The AFVR equipment included a liquid ring pump, a 3,000-gallon capacity tanker, flexible vacuum hoses, 6- foot discharge stack (6 inches in diameter), 1-inch diameter PVC stinger pipes and associated couplings and pipe fittings to manifold to the wells. The AFVR system was rated at 1,450 cfm at 22 in./Hg. The extraction and observation wells were gauged and purged prior to the start of the event. Recovery well RW-2 was vacuumed continuously for the 8-hour event. During the event, measurements of relative humidity, temperature, vacuum, exhaust velocity and off-gas concentrations were recorded at the discharge stack every 15 minutes for the first two hours, and every 30 minutes thereafter during the event. Vacuum at the extraction well ranged from 20.0 to 27.0 in./Hg. during the event. The effluent velocity ranged from 169 to 1,400 feet per minute. The system temperature ranged from 57.3 to 117.9°F and relative humidity ranged from 88.2 to 100 percent. The VOC off-gas concentrations increased from 62.9 ppm to 327.2 ppm during the event. The AFVR calculations have been included as Appendix C. A summary of the gauging data for the November 15, 2023, AFVR event has been listed below: Well ID Product Thickness before Recovery (feet) Product Thickness after Recovery (feet) Amount of Liquid Recovered (gallons) Amount of Product Recovered as Liquid (gallons) RW-2 0.00 0.00 482.0 0.00 ___________________________________________________________________________________________ Prepared by: Geological Resources, Inc. Free Product Recovery Report – November 15, 2023 Prepared on: December 5, 2023 Shields Exxon Project Manager: William L. Regenthal, P. G. GRI Project No. 3913 4 The results of the AFVR event indicate that a total of 482 gallons of liquids were removed during the event. Of the total liquids extracted, no measurable free product was observed in the tanker at the conclusion of the event. Based on 8 hours of operation, the average liquid recovery rate was 60.25 gallons per hour. Based on mass-removal calculations 25.56 pounds or 4.09 gallons of VOCs were removed as vapor. No measurable free product was identified during the event. Summaries of AFVR event information and cost analysis are provided in Tables 5, 6 and 7, respectively. A copy of the liquid disposal manifest is included as Appendix D. At the conclusion of the AFVR event, all wastewater was transported to a permitted facility for disposal. A summary of the free product recovery data from the November event is listed below: Well ID Average Effluent Velocity (ft/min) Average Effluent Temperature (°F) Average Effluent Concentration (ppm) Amount of Vaporized Product (gallons) Amount of Liquid Recovered (gallons) Amount of Product Recovered as Liquid (gallons) Total Amount of Product Recovered (gallons) RW-2 954.0 104.2 218.70 4.09 482.0 0 4.09 Totals to Date 9.67 2,523.9 1.00 9.67 5.0 PROPOSED REMEDIAL OPTIONS CAP activities should be completed for the site. In the interim, efforts for recovering free product should continue with another MMPE and/or AFVR event on wells with free product (RW-1 and RW-4). Quarterly ground water monitoring should continue in order to establish contaminant trends at the site while the feasibility of corrective action options is being discussed. Once free product is removed and contaminant concentrations remain less than the GCLs for at minimum two consecutive sampling events, concentrations that exceed greater than ten times the 2B surface water standards can be addressed. 6.0 CONCLUSIONS  On November 15, 2023, an AFVR event was conducted at the site on RW-2. A total of 482 gallons of affected ground water was recovered during the AFVR event. No measurable liquid free product was recovered during this AFVR event. The average liquid recovery rate was 60.25 gallons per hour. A total of 4.09 gallons of vapor phase free product was removed during the event at a rate of 0.51 gallons per hour.  Free product removal should continue at the site until free product is no longer present. Additional quarterly ground water sampling events should be conducted to establish contaminant trends for the site while the feasibility of corrective action options are discussed.  Based on this information, GRI recommends that a sampling event should occur within 30 days to evaluate the results of the November 15, 2023, AFVR event. 7.0 LIMITATIONS This report has been prepared for the exclusive use of McNeill Oil Company, Inc. for specific application to the referenced site in Moore County, North Carolina. The assessment was conducted based on the scope of work and level of effort desired by NCDEQ and with resources adequate only for that scope of work. Our findings have been developed in accordance with generally accepted standards of FIGURES SITE NC 5 HWY N POPLAR STE MAIN ST N SYCAMORE STBLUE STPAGE STELM ST PINEHURST STHIGH ST FAYETTEVILLE ST BETHESDA AVE W SAUNDERS AVE CYPRESS STWILDER AVE RUSH ST OCONNOR PL 857013138918 857013139659 857013137711 857013138433 857013230791 857013230823 857013139479 857013230505 857013230529KEITH STW MAPLE AVEN SANDHILLS BLVDN SANDHILLS BLVDN PINE STS SANDHILLS BLVDS SANDHILLS BLVDE SOUTH ST E MAPLE AVE S PINE STKNIGHT ST W MA I N S T S SYCAMORE STS GARRETT STTARBELL STW SOUTH ST SUMMIT ST WALNUT STS POPLAR STT B CREEL ST EXCHANGE STLAKE PARK CROSSINGLAKE PARK CROSSINGE SAUNDERS AVE TALBOOTH STCAROLINA STCAMPBELL STLAKESHORE DRGLASGOW STFAIRVIEW AVE HIGH ST 250-FT RADIUS 500-FT RADIUS 1,000-FT RADIUS 1,500-FT RADIUS Legend Subject Parcel Stream or Creek Line Street Centerline Railroad Track Lake or Pond Parcel Boundary FIGURE 2SITE VICINITY MAPSHIELDS EXXON - ABERDEEN100 NORTH SANDHILLS BOULEVARD ABERDEEN, MOORE COUNTY, NORTH CAROLINAINCIDENT NO. 2509 PREPARED BY:GEOLOGICAL RESOURCES, INC.SEPTEMBER 28, 2015 NOTE:THIS MAP IS BASED ON DATA FROMTHE MOORE COUNTY GIS OF NC. 0 300 600150Feet SCALE: 1 INCH = 300 FEET ³Parcel ID Number857013139659 FIGURE 3 TABLES UST ID Number 1 - 5 Facility ID Number Owner or Operator? Owner/OperatorMcNeill Oil Company, Inc.05/04/1975 - 05/16/2000 Address Telephone Number Post Office Box 396, Aberdeen, NC 28315-0396 910-944-2329 TABLE 1 UST OWNER/OPERATOR INFORMATION SHIELDS EXXON (INCIDENT NO. 2509) 00-0-0000020676 Name of Owner or Operator Dates of Ownership / Operation Date: 06/24/19 Was Release Associated with UST System? (Yes / No) 1 Gasoline Gasoline 4,000 Unknown Unknown Unknown Yes 2 Gasoline Gasoline 4,000 Unknown Unknown Unknown Yes 3 Gasoline Gasoline 4,000 Unknown Unknown Unknown Yes 4 Gasoline Gasoline 2,000 Unknown Unknown Unknown Yes 5 Gasoline Gasoline 2,000 Unknown Unknown Unknown Yes Current or Most Recent Contents Previous Contents Capacity (gallons) Date Installed Construction Details 05/04/1975 Removed (05/16/00) Tank Dimensions Description of Associated Product Piping and Pumps Status of UST TABLE 2 UST SYSTEM INFORMATION SHIELDS EXXON (INCIDENT NO. 2509) Facility ID #: 00-0-0000020676 UST ID No. Date: 06/19/19 Facility ID #: 0-020676 857013139659 (Site)MC, B, MC, LLC Post Office Box 396 Aberdeen, North Carolina 28315 857013230823 Moore County Farm Bureau, Inc.Post Office Box 430 Carthage, North Carolina 28327-0430 857013230791 857013230529 857013138918 857013230505 Bobby R. & Teresa Faulkner Post Office Box 268 Southern Pines, North Carolina 28388 857013139479 McPeake Retail Group, LLC Post Office Box 1497 Southern Pines, North Carolina 28388 857013138433 First Bank Post Office Box 508 Troy, North Carolina 27371 857013137711 Mubarak A. Shahbain Post Office Box 2048 Raeford, North Carolina 28376 • Properties are keyed to Figure 3. Town of Aberdeen Post Office Box 785 Aberdeen, North Carolina 27315 • This information is based on the Moore County GIS website. TABLE 3 ADJACENT PROPERTY OWNER INFORMATION SHIELDS EXXON (INCIDENT NO. 2509) PIN Number Property Owner Name Mailing Address Date: 11/30/2023 09/10/15 NM NM NM Not Found 11/29/17 NM NM NM Not Found 06/05/19 NM NM NM Not Found 09/30/20 NM NM NM Not Found 02/14/22 NM NM NM Not Found 09/10/15 8.07 ---91.23 11/29/17 8.06 ---91.24 06/05/19 7.73 ---91.57 09/30/20 7.01 ---92.29 05/26/21 7.77 ---91.53 02/14/22 7.32 ---91.98 09/08/22 8.21 ---91.09 03/23/23 7.36 ---91.94 09/06/23 7.99 ---91.31 09/10/15 7.95 ---91.25 11/29/17 7.96 ---91.24 06/05/19 7.66 ---91.54 09/30/20 6.97 ---92.23 05/26/21 7.70 ---91.50 02/14/22 7.36 ---91.84 09/08/22 8.01 ---91.19 03/23/23 7.38 ---91.82 09/06/23 6.78 ---92.42 11/15/23 8.32 ---90.88 Before AFVR 11/15/23 8.31 ---90.89 After AFVR 09/10/15 7.67 ---91.30 11/29/17 7.69 ---91.28 06/05/19 7.45 ---91.52 09/30/20 6.67 ---92.30 05/26/21 7.45 ---91.52 02/14/22 7.12 ---91.85 09/08/22 7.72 ---91.25 03/23/23 7.12 ---91.85 09/06/23 7.50 ---91.47 09/10/15 8.41 ---91.72 11/29/17 NM NM NM Not Found 06/05/19 NM NM NM Not Found 09/30/20 NM NM NM Not Found 05/26/21 NM NM NM Not Found 02/14/22 NM NM NM Not Found 09/30/20 7.02 ---92.35 05/26/21 7.71 ---91.66 02/14/22 7.43 ---91.94 09/08/22 8.02 ---91.35 03/23/23 7.43 ---91.94 09/06/23 7.85 ---91.52 11/15/23 8.24 ---91.13 Before AFVR 11/15/23 8.31 ---91.06 After AFVR 09/30/20 6.38 ---92.49 05/26/21 7.18 ---91.69 02/14/22 6.91 ---91.96 09/08/22 7.48 ---91.39 03/23/23 6.77 ---92.10 09/06/23 7.25 ---91.62 11/15/23 7.72 ---91.15 Before AFVR 11/15/23 7.73 ---91.14 After AFVR 09/30/20 7.93 0.12 92.47 05/26/21 9.10 0.45 91.59 02/14/22 NM NM NM FP observed in bailer 08/01/22 8.69 0.02 91.63 Before MMPE 08/05/22 8.79 ---91.51 After MMPE 09/08/22 8.04 ---92.26 03/23/23 8.51 ---91.79 09/06/23 8.70 ---91.60 3 MW-7 99.3709/29/20MW-6 133-13 5.5 09/29/20MW-8 MW-2 15.55.5-15.5 18 100.30133-13 Screened Interval (x to y ft. BGS) MW-5 8-18 209/29/20 8 11.5 100.001.5 1.5-11.5 3 09/16/92 3-13309/15/92 98.97 Depth to Water from Top of Casing (ft) Ground Water Elevation (ft.) 100.1309/16/92 99.3013 07/29/92MW-1 TABLE 4 WELL CONSTRUCTION AND GAUGING INFORMATION SHIELDS EXXON (INCIDENT NO. 2509) Facility ID # : 00-0-0000020676 Well ID Date Installed (mm/dd/yy) Date Water Level Measured (mm/dd/yy) Free Product Thickness (ft.)** Comments Bottom of Well (ft. BGS) Top of Casing Elevation* (ft.) Well Casing Depth (ft. BGS) 98.87122-12 99.2012.32.3-12.32.309/15/92MW-3 MW-4 Page 1 of 3 Date: 11/30/2023 Screened Interval (x to y ft. BGS) Depth to Water from Top of Casing (ft) Ground Water Elevation (ft.) TABLE 4 WELL CONSTRUCTION AND GAUGING INFORMATION SHIELDS EXXON (INCIDENT NO. 2509) Facility ID # : 00-0-0000020676 Well ID Date Installed (mm/dd/yy) Date Water Level Measured (mm/dd/yy) Free Product Thickness (ft.)** Comments Bottom of Well (ft. BGS) Top of Casing Elevation* (ft.) Well Casing Depth (ft. BGS) 05/26/21 8.89 ---91.64 02/14/22 8.36 ---92.17 09/08/22 9.03 ---91.50 03/23/23 8.31 ---92.22 09/06/23 8.89 ---91.64 05/26/21 8.17 ---91.68 02/14/22 8.02 ---91.83 09/08/22 8.37 ---91.48 03/23/23 8.02 ---91.83 09/06/23 8.19 ---91.66 05/26/21 7.69 ---91.90 02/14/22 7.35 ---92.24 09/08/22 7.97 ---91.62 03/23/23 7.32 ---92.27 09/06/23 7.64 ---91.95 05/26/21 9.08 ---91.68 02/14/22 8.61 ---92.15 09/08/22 9.41 0.09 91.43 03/23/23 8.33 ---92.43 09/06/23 ---------NF 03/23/23 7.66 ---91.38 09/06/23 7.80 ---91.24 03/23/23 5.54 ---91.53 09/06/23 6.41 ---90.66 03/23/23 4.91 ---91.52 09/06/23 5.92 ---90.51 03/23/23 0.94 ---91.11 09/06/23 1.15 ---90.90 03/23/23 1.39 ---89.47 09/06/23 1.66 ---89.20 09/10/15 7.85 0.44 91.53 11/30/15 7.21 0.40 92.13 11/29/17 7.64 0.13 91.47 06/05/19 7.90 0.58 91.60 09/30/20 6.75 0.15 92.38 05/26/21 8.30 1.08 91.63 02/14/22 NM NM NM FP observed in bailer 08/01/22 7.65 0.32 91.62 Before MMPE 08/05/22 7.44 0.01 91.57 After MMPE 09/08/22 7.66 0.13 91.45 03/23/23 7.76 0.65 91.80 09/06/23 8.02 0.74 91.41 11/14/23 8.26 0.51 92.11 Before AFVR 11/14/23 7.91 0.09 91.17 After AFVR 02/15/22 7.56 ---92.76 08/01/22 7.69 0.03 92.66 Before MMPE 08/05/22 7.72 ---92.60 After MMPE 09/08/22 7.85 ---92.47 03/23/23 7.50 ---92.82 09/06/23 7.80 ---92.52 11/15/23 8.10 ---92.22 Before AFVR 11/15/23 8.09 ---92.23 After AFVR 02/15/22 7.46 ---92.25 09/08/22 8.02 ---91.69 03/23/23 7.09 ---92.62 09/06/23 7.70 ---92.01 02/01/22 8.47 ---92.04 08/01/22 8.14 0.16 92.51 Before MMPE 08/05/22 8.93 ---91.58 After MMPE 09/08/22 9.02 0.03 91.52 03/23/23 7.94 0.37 92.89 09/06/23 8.46 0.79 92.73 02/15/22 7.43 ---92.56 09/08/22 8.11 ---91.88 03/23/23 7.16 ---92.83 09/06/23 7.45 ---92.54 05/26/21 3 3MW-11 Unknown 12 99.00 99.59 13 100.76133-1305/26/21MW-12 MW-10 05/26/21 99.85 100.53 3 05/26/21MW-9 13 133-133 3-13 3 - 1303/13/23MW-13 MW-14 MW-15 03/13/23 3 3 3-13 97.07 13 96.43 13 13 92.05 99.04 3 - 13 3 - 13 3 03/13/23 03/13/23 MW-16 3 RW-1 Unknown 3 Unknown 90.86133 - 13 3 - 13 MW-17 RW-5 3-13 13 3 3-13 03/13/23 RW-3 RW-4 02/14/22 02/14/22 02/14/22 3 3 13 100.5113 99.99 3-13 13 99.71 3-13 100.3213302/14/22RW-2 Page 2 of 3 Date: 11/30/2023 Screened Interval (x to y ft. BGS) Depth to Water from Top of Casing (ft) Ground Water Elevation (ft.) TABLE 4 WELL CONSTRUCTION AND GAUGING INFORMATION SHIELDS EXXON (INCIDENT NO. 2509) Facility ID # : 00-0-0000020676 Well ID Date Installed (mm/dd/yy) Date Water Level Measured (mm/dd/yy) Free Product Thickness (ft.)** Comments Bottom of Well (ft. BGS) Top of Casing Elevation* (ft.) Well Casing Depth (ft. BGS) 03/23/23 10.18 ---89.67 09/06/23 7.42 ---92.43 Notes: • ** : If free product is present in a well, groundwater elevation calculated by: [Top of Casing Elevation - Depth to Water] + [free product thickness x 0.8581]. • NF: Well Not Found. • Top-of-casing elevations are reproduced from the previous consultant's report. TW-1 03/16/23 3631 - 3631 99.85 • NM: Not Measured. • ft BGS : feet below ground surface. • *: Reference point for elevation measurements, assumed elevation 100.00 ft. Page 3 of 3 Date: 11/30/2023 Method of Measurement: Well ID Product Type (gas, diesel, etc.) Date of Recovery (mm/dd/yy) Free Product Recovery Method* Casing Diameter (inches) Product Thickness before Recovery (feet) Product Thickness after Recovery (feet) Amount of Liquid Recovered (gallons) Amount of Product Recovered as Liquid (gallons) MW-8 2 NM 0.00 RW-1 4 NM 0.00 MW-8 2 0.02 0.00 RW-1 4 0.32 0.01 RW-2 4 0.03 0.00 RW-4 4 0.16 0.00 RW-1 4 0.74 0.00 RW-4 4 0.79 0.00 RW-1 11/14/23 AFVR 4 0.51 0.09 526.00 0.00 RW-2 11/15/23 AFVR 4 0.00 0.00 482.00 0.00 Notes : • *: Bailing, Skimming, Aggressive Fluid Vapor Recovery (AFVR), Mobile Multiphase Extraction (MMPE) • **: No free product was observed during initial gauging event; however, free product entered the well during purging activities. • Amount of Liquid Recovered (gallons) includes Total liquids (Water and Free Product) as indicated on Disposal Manifest. • Amount of Product Recovered (in gallons) includes only the volume of free product in the tanker at the end of the event (based on Disposal Manifest and/or Field Notes). 1.00 TABLE 5 FREE PRODUCT RECOVERY RESULTS SHIELDS EXXON (INCIDENT NO. 2509) Facility ID#: 00-0-0000020676 Interface probe at top-of-casing Gasoline Hand Bailing 09/06/23 02/14/22 0.001,500.0MMPE08/01/2022 - 08/05/2022 NM14.5 Hand Bailing 1.35 Date: 11/30/2023 MW-8 N/A N/A N/A N/A RW-1 N/A N/A N/A N/A MW-8 RW-1 RW-2 RW-4 RW-1 N/A N/A N/A N/A RW-4 N/A N/A N/A N/A RW-1 11/14/23 AFVR 1,175.00 93.1 189.90 3.95 526.00 0.00 3.95 RW-2 11/15/23 AFVR 954.00 103.9 218.70 4.09 482.00 0.00 4.09 9.67 2,523.9 1.00 10.67 Notes: • *: Bailing, Skimming, Aggressive Fluid Vapor Recovery (AFVR), Mobile Multiphase Extraction (MMPE) • Amount of Vaporized Product (in gallons) is based on Vapor Emissions Summary Sheet, = lbs emitted/6.15 • Amount of Liquid Recovered includes Total liquids (Water and Free Product) as indicated on Disposal Manifest. • Amount of Product Recovered as Liquid includes only the volume of free product in the tanker at the end of the event (based on Disposal Manifest and/or Field Notes). • Total Amount of Product Recovered = Amount of Vaporized Product + Amount of Product Recovered as Liquid • Total Fluids Removed = Amount of Vaporized Product + Amount of Liquid Recovered • Information regarding historical free product recovery activities is not available. • NM = Not Measured 1.00 1.00 TABLE 6 FREE PRODUCT RECOVERY EVENT INFORMATION SHIELDS EXXON (INCIDENT NO. 2509) Facility ID #: 00-0-0000020676 Well ID Date (mm/dd/yy) Product Recovery Method* Average Effluent Velocity (ft/min) Average Effluent Temperature (°F) Average Effluent Concentration (ppm) Summary Total Fluids Removed (in gallons) Hand Bailing02/14/22 09/06/23 Hand Bailing Amount of Vaporized Product (gallons) Amount of Liquid Recovered (gallons) Amount of Product Recovered as Liquid (gallons) Total Amount of Product Recovered (gallons) 826.80 1.630787.75 14.5 NM Total To Date 2,533.52 10.67 Totals SUMMARY OF FLUID REMOVAL Total Product Removed (in gallons) NM 1,500.0MMPE1.63 Current Event 486.09 4.09 08/01/2022 - 08/05/2022 97.84 1.35 Date: 11/30/2023 Facility ID #: 00-0-0000020676 Wells Included in Event Product Recovery Method* Date of Event (mm/dd/yy) Total Amount of Free Product plus Ground Water Recovered (gallons) Cost of Free Product Recovery Event Cost Per Gallon (total fluids) Cost Per Gallon of Free Product (liquid and vapor) Comments MW-8 RW-1 MW-8, RW-1, RW-2 & RW-4 MMPE 08/01/22 - 08/05/22 1,501.63 $8,194.00 $0.18 $5,026.99 Cost per gallon for the event is based on a total volume of 1,501.63 gallons of free product and water. RW-1, RW-4 Hand Bailing 09/06/23 1.35 $255.98 $189.61 $255.98 Cost per gallon for the event is based on a total volume of 1.35 gallons of free product and water. RW-1 AFVR 11/14/23 529.95 $3,238.10 $6.11 $819.77 Cost per gallon for the event is based on a total volume of 529.95 gallons of free product and water. RW-2 AFVR 11/15/23 486.09 $3,088.70 $6.35 $755.18 Cost per gallon for the event is based on a total volume of 486.09 gallons of free product and water. 2,533.52 $15,030.96 $5.93 Notes: • *: Bailing, Skimming, Aggressive Fluid Vapor Recovery (AFVR), Mobile Multiphase Extraction (MMPE) • Total Amount of Free Product Recovered = Amount of Vaporized Product + Amount of Product Recovered as Liquid NM02/14/22Hand Bailing TABLE 7 FREE PRODUCT RECOVERY COST SUMMARY SHIELDS EXXON (INCIDENT NO. 2509) TOTAL (to date) • Cost of Free Product Recovery Event includes supervision, travel, mileage, per diem, subcontractor costs, MMPE sampling, MMPE sampling analytical, report preparation (pre-2015 only) and project management. Cost per gallon for the event is based on a total volume of 14.5 gallons of free product and water.$17.53$254.18 14.50 APPENDICES APPENDIX A State Correspondence EtD 'E 2FWREHU )UDQN0F1HLOO-U 32R EHUGHHQ1 5HURQGDWHU0RQLWRULQJ5HSRUW5HLH 6LHOGV(RQ 1RUW6DQGLOOV5RDG EHUGHHQ0RRUHRQW ,QFLGHQW1PEHU 5LVNODVVLILFDWLRQ,QWHUPHGLDWH 5DQNLQJ, HDU)UDQN0F1HLOO-U 7H8QGHUJURQG6WRUDJH7DQN8676HFWLRQLLVLRQRI:DVWH0DQDJHPHQW:0LVLQUHFHLSWRI WHUHSRUWGDWHG6HSWHPEHUVEPLWWHGRQRUEHDOIEHRORJLFDO5HVRUFHV,QF5,7H UHSRUWDVEHHQUHLHHGDQGLOOEHPDLQWDLQHGLQWH)DHWWHLOOH5HJLRQDO2IILFH7H867VHFWLRQ ROGOLNHWRDGMVWWHUHFRPPHQGDWLRQVSUHVHQWHGLQWHODVWJURQGDWHUPRQLWRULQJUHSRUW ,WDVUHFRPPHQGHGWRSHUIRUPDQG0RELOH0OWL3DVH(WUDFWLRQ003(HHQWRQWHWRHOOV LWIUHHSURGFW5:DQG5:HWRWHLJFRVWRIUHFRHURISURGFWGULQJWH003(DPOWLGDJJUHVVLH)OLG9DSRU5HFRHU)95VROGEHFRQGFWHGRQIUHHSURGFWHOOV5: DQG5:LNHLVHPRQLWRULQJHOO0:VROGEHLQFOGHGDVSDUWRIWH)95GHWRWHSURLPLW WRWHQHDUEFUHHNDQGLJFRQFHQWUDWLRQV7LVLOOJLHWHFRVWIRUIUHHSURGFWUHFRHUHIIRUWVDQG FRVWDVVRFLDWHGLWWHDULRVWHFQRORJLHVWRGHWHUPLQHDWPDEHWHPRVWFRVWHIIHFWLHIRUWHVLWH)ROORLQJWH)95HHQWDQRWHUVDPSOLQJHHQWVROGEHFRQGFWHGDSSURLPDWHOGDVDIWHUWH )95LVFRQFOGHGDVDVHSDUDWHWDVNDWRULDWLRQ7 3OHDVHVEPLWWHUHSRUWLQFOGLQJWDEOHVIRUDOOIUHHSURGFWUHFRHUWRGDWHLWFRVWFRPSDULVRQEHWHHQ FRVWRIHHQWFRVWSHUJDOORQRIIUHHSURGFWDQGDWHUUHFRHUDQGFRVWSHUJDOORQRIMVWIUHHSURGFW IRUHDFWHFQRORJLPSOHPHQWHG EtD ,I6WDWH7UVW)QGUHLPEUVHPHQWLVDQWLFLSDWHGSOHDVHVEPLWDFRPSOHWHGSUHDSSURDOIRUPWRWHLLVLRQEHIRUHDQRUNDVEHHQFRPSOHWHG,IRDHDQTHVWLRQVUHJDUGLQJWUVWIQGHOLJLELOLWRUUHLPEUVHPHQWSOHDVHFRQWDFWWH8676HFWLRQ7UVW)QGUDQFDW,IRDHDQ THVWLRQVUHJDUGLQJWLVOHWWHUSOHDVHFRQWDFWPHDWFRUHIWUDOGHTQFJRRU 6LQFHUHO RUH)WUDO GURJHRORJLVW :LOPLQJWRQ5HJLRQDO2IILFH 8676HFWLRQLLVLRQRI:DVWH0DQDJHPHQW1(4 FF:LOOLDP5HJHQWDO35,,QFLDHPDLO 3913 Received OCT 17 2023 APPENDIX B Historical Soil Quality Information and Cross Section Maps Date: 10/21/2020 Facility ID # : 0-020676 Sample ID Date Collected (mm/dd/yy) Sample Depth (ft-BGS) 50 100 SB-1-4 12/04/19 4 9.7 16.2 SB-1-7 12/04/19 7 651 1,117 SB-1-10 12/04/19 10 107.2 21.5 SB-2-4 12/04/19 4 40.1 303 SB-2-7 12/04/19 7 768.5 409.5 SB-2-10 12/04/19 10 13,231 1,218 SB-3-4 12/04/19 4 28.7 70.1 SB-3-7 12/04/19 7 3,741 2,965 SB-3-10 12/04/19 10 1,440 197.4 SB-4-4 12/04/19 4 275.1 308.6 SB-4-7 12/04/19 7 370.6 106.3 SB-4-10 12/04/19 10 16,680 16,766 SB-5-4 12/04/19 4 <0.58 4.1 SB-5-7 12/04/19 7 762.1 430.4 SB-5-10 12/04/19 10 5.5 <0.58 SB-6-4 12/04/19 4 8.4 10.2 SB-6-7 12/04/19 7 4,777 7,587 SB-6-10 12/04/19 10 <0.56 6.8 SB-7-4 12/04/19 4 <37.1 1,657 SB-7-7 12/04/19 7 873.8 4,758 SB-7-10 12/04/19 10 296.2 32 SB-8-4 12/04/19 4 <1.1 134.7 SB-8-7 12/04/19 7 189.7 479 SB-8-10 12/04/19 10 30 <0.53 SB-9-4 12/04/19 4 <0.58 63 SB-9-7 12/04/19 7 198.4 186.1 SB-9-10 12/04/19 10 <0.51 <0.51 SB-10-4 12/04/19 4 <0.76 <0.76 SB-10-7 12/04/19 7 5,152 4,353 SB-10-10 12/04/19 10 43.5 39.8 SB-11-4 12/04/19 4 4.5 7.5 SB-11-7 12/04/19 7 186.1 292.6 SB-11-10 12/04/19 10 6,127 588.6 SB-12-4 12/04/19 4 <0.52 1.1 RAL (mg/kg) TABLE 4 SUMMARY OF SOIL SAMPLE ANALYTICAL RESULTS SHIELDS EXXON (INCIDENT NO. 2509) Analytical Method UVF Contaminant of Concern Gasoline-Range TPHDiesel-Range TPH Date: 10/21/2020 Facility ID # : 0-020676 Sample ID Date Collected (mm/dd/yy) Sample Depth (ft-BGS) 50 100RAL (mg/kg) TABLE 4 SUMMARY OF SOIL SAMPLE ANALYTICAL RESULTS SHIELDS EXXON (INCIDENT NO. 2509) Analytical Method UVF Contaminant of Concern Gasoline-Range TPHDiesel-Range TPHSB-12-7 12/04/19 7 628 674.6 SB-12-10 12/04/19 10 <0.43 <0.43 SB-13-7 09/30/20 7 0.5 13.8 SB-13-10 09/30/20 10 109 7.3 SB-14-7 09/30/20 7 176.8 125.9 SB-14-10 09/30/20 10 0.4 0.24 SB-15-7 09/30/20 7 1,119 286.8 SB-15-10 09/30/20 10 <0.5 0.4 SB-16-7 09/30/20 7 31.6 10.6 SB-16-10 09/30/20 10 <0.5 0.23 SB-17-7 09/30/20 7 148.3 9 SB-17-10 09/30/20 10 <0.4 1.6 SB-18-7 09/30/20 7 21 8.7 SB-18-10 09/30/20 10 137.5 56.4 SB-19-7 09/30/20 7 <0.4 5.9 SB-19-10 09/30/20 10 66.9 11.9 SB-20-7 09/30/20 7 376 318 SB-20-10 09/30/20 10 <0.5 <0.23 SB-21-7 09/30/20 7 1,243 48.5 SB-21-10 09/30/20 10 3 <0.22 SB-22-7 09/30/20 7 273.6 81.9 SB-22-10 09/30/20 10 63.4 54.3 • RAL: Regulatory Action Level. • < : Less than the UFV method detection limit . • Concentrations in bold face type indicate the RALs were Notes: • Results reported in mg/kg; samples analyzed onsite by • ft-BGS: feet below ground surface. APPENDIX C AFVR Data and Calculations Site Name:2509 Extraction Well(s):4 6 Date :11/15/23 Start Time :7:45 End Time :15:45 Frequency (min)Time Vacuum (in. of Hg) Exhaust Velocity (ft/min) Temperature (°F) Rel. Humidity (%) OVA (ppm) 0 7:45 27.0 169 57.3 90.1 62.9 15 8:00 20.0 732 74.6 93.7 230.1 30 8:15 20.0 1,400 85.1 100.0 233.8 45 8:30 20.0 884 94.8 100.0 221.1 60 8:45 20.0 782 97.5 100.0 168.6 75 9:00 20.0 803 96.5 100.0 158.9 90 9:15 20.0 956 108.1 100.0 157.6 105 9:30 20.0 946 107.2 100.0 162.3 120 9:45 20.0 1,132 112.1 100.0 221.3 150 10:15 20.0 1,276 110.1 100.0 182.9 180 10:45 20.0 1,078 105.4 100.0 290.7 210 11:15 20.0 1,029 108.5 100.0 209.5 240 11:45 20.0 899 115.2 100.0 255.7 270 12:15 20.0 954 116.6 100.0 176.5 300 12:45 20.0 1,031 113.7 97.5 217.2 330 13:15 20.0 1,033 115.4 94.0 204.7 360 13:45 20.0 1,126 100.5 88.2 177.8 390 14:15 20.0 1,095 114.0 100.0 318.4 420 14:45 20.0 815 117.9 100.0 327.2 450 15:15 20.0 954 116.1 100.0 305.1 480 15:45 20.0 940 115.7 100.0 311.1 Total Fluids Recovered (in gallons) : Total Product Recovered (in gallons) : Note: Take all the readings listed below every 15 minutes for the first 2 hours of the AFVR and every 30 minutes thereafter. 1450 cfm @22 in. of HgBlower Specifications For Vacuum Truck (e.g: 2500 cfm @ 24 in. of Hg): 0 AGGRESSIVE FLUID VAPOR RECOVERY EVENT - DATA SHEET Diameter of Exhaust Stack (inches) : Eastern Environmental Management Geological Resources, Inc. Test Conducted By (AFVR Contractor): Test Supervised By (Consultant): 482 Shields Exxon Incident Number: Inner Dia. of Well (inches):RW-2 Page 1 of 2 Site Name:2509 Extraction Well(s):4 6 Date :11/15/23 Start Time :7:45 End Time :15:45 1450 cfm @22 in. of HgBlower Specifications For Vacuum Truck (e.g: 2500 cfm @ 24 in. of Hg): AGGRESSIVE FLUID VAPOR RECOVERY EVENT - DATA SHEET Diameter of Exhaust Stack (inches) : Eastern Environmental Management Geological Resources, Inc. Test Conducted By (AFVR Contractor): Test Supervised By (Consultant): Shields Exxon Incident Number: Inner Dia. of Well (inches):RW-2 AFVR Well Obs. Well 1 Obs. Well 2 Obs. Well 3 Obs. Well 4 Well Name RW-2 MW-3 MW-6 MW-7 Diameter (in.)4 2 2 2 Distance from AFVR Well (ft)0 45 58 37 Frequency (min)Time RW-2 MW-3 MW-6 MW-7 Pre AFVR 7:30 8.10 8.32 8.24 7.72 60 8:45 8.33 8.28 7.77 120 9:45 8.33 8.30 7.79 180 10:45 8.32 8.30 7.79 240 11:45 8.32 8.30 7.79 300 12:45 8.31 8.31 7.80 360 13:45 8.31 8.31 7.80 420 14:45 8.30 8.31 7.80 480 15:45 8.29 8.31 7.78 Post AFVR 15:30 8.09 8.29 8.31 7.78 Note: Record water levels in Vacuum Well at start and end of AFVR. Record Water Levels in a few Observation Wells periodically (hourly during event) and at end of event. Depth to Water Measurements (in feet) Page 2 of 2 Site Name:2509 Extraction Well(s):2 6 Date:Start Time:End Time : AIR FLOW CALCULATIONS Date Time Vacuum (in. Hg) Velocity (ft/min) Pipe ID (in.) Temp (°F) Rel Humid (%) Water Vapor (%) Flow (DSCFM) 7:45 27.0 169 6 57.3 90.1 0.0092 34 8:00 20.0 732 6 74.6 93.7 0.0176 139 8:15 20.0 1,400 6 85.1 100.0 0.0269 259 8:30 20.0 884 6 94.8 100.0 0.0370 159 8:45 20.0 782 6 97.5 100.0 0.0404 140 9:00 20.0 803 6 96.5 100.0 0.0391 144 9:15 20.0 956 6 108.1 100.0 0.0568 165 9:30 20.0 946 6 107.2 100.0 0.0552 163 9:45 20.0 1,132 6 112.1 100.0 0.0645 192 10:15 20.0 1,276 6 110.1 100.0 0.0605 218 10:45 20.0 1,078 6 105.4 100.0 0.0521 187 11:15 20.0 1,029 6 108.5 100.0 0.0575 177 11:45 20.0 899 6 115.2 100.0 0.0711 151 12:15 20.0 954 6 116.6 100.0 0.0743 159 12:45 20.0 1,031 6 113.7 97.5 0.0661 174 13:15 20.0 1,033 6 115.4 94.0 0.0672 174 13:45 20.0 1,126 6 100.5 88.2 0.0393 200 14:15 20.0 1,095 6 114.0 100.0 0.0684 184 14:45 20.0 815 6 117.9 100.0 0.0774 135 15:15 20.0 954 6 116.1 100.0 0.0731 159 15:45 20.0 940 6 115.7 100.0 0.0722 157 20.3 954 6 103.9 98.3 0.0536 165 NOTES Qstd = (1-Water Vapor) * velocity * (PI * (diameter/24)^2) * (528°R/(Temp + 460)) (DSCFM) Vacuum = The level of vacuum being applied should be recorded from the vacuum truck tank (inches of Hg) Velocity = The rate at which air flows is measured at the blower discharge piping (anemometer or pitot tube) Pipe ID = The inside diameter of the blower discharge piping (from the vacuum truck) Temperature = The temperature of the air stream exiting the blower discharge piping (dry bulb temp., in deg.°F) Relative humidity = The % relative humidity of the air stream exiting the blower discharge piping Water Vapor in % = Pounds of water per pound of dry air, derived from the Psychrometric chart (temp Vs relative humidity) DSCFM = Dry Standard Cubic Feet Per Minute 11/15/23 333Site Elevation (feet): 15:457:4511/15/23 AGGRESSIVE FLUID VAPOR RECOVERY EVENT - CALCULATIONS Averages Shields Exxon Blower Specifications For Vacuum Truck (e.g: 2500 cfm @ 24 in. of Hg):1450 cfm @22 in. of Hg Test Conducted By (AFVR Contractor): Test Supervised By (Consultant): Eastern Environmental Management Geological Resources, Inc. Diameter of Exhaust Stack (inches) : Inner Dia. of Well (inches):RW-2 Incident Number: Page 1 of 2 Site Name:2509 Extraction Well(s):2 6 Date:Start Time:End Time : 333Site Elevation (feet): 15:457:4511/15/23 AGGRESSIVE FLUID VAPOR RECOVERY EVENT - CALCULATIONS Shields Exxon Blower Specifications For Vacuum Truck (e.g: 2500 cfm @ 24 in. of Hg):1450 cfm @22 in. of Hg Test Conducted By (AFVR Contractor): Test Supervised By (Consultant): Eastern Environmental Management Geological Resources, Inc. Diameter of Exhaust Stack (inches) : Inner Dia. of Well (inches):RW-2 Incident Number: EMISSION CALCULATIONS Elapsed Time (min) Flow (DSCFM) PPM measured (ppm) K (#C-gas)PPMg Cg:m (mg/dsm^3) Cg (lb/dscf) PMRg (lb/hr) PMR (lb) 0 34 62.9 4 251.6 1,337.96 0.00008353 0.17 0.00 15 139 230.1 4 920.4 4,894.52 0.00030557 2.56 0.64 30 259 233.8 4 935.2 4,973.23 0.00031048 4.83 1.21 45 159 221.1 4 884.4 4,703.08 0.00029361 2.80 0.70 60 140 168.6 4 674.4 3,586.34 0.00022390 1.87 0.47 75 144 158.9 4 635.6 3,380.01 0.00021101 1.82 0.45 90 165 157.6 4 630.4 3,352.36 0.00020929 2.07 0.52 105 163 162.3 4 649.2 3,452.33 0.00021553 2.11 0.53 120 192 221.3 4 885.2 4,707.34 0.00029388 3.38 0.85 150 218 182.9 4 731.6 3,890.52 0.00024289 3.18 1.59 180 187 290.7 4 1,162.8 6,183.56 0.00038604 4.34 2.17 210 177 209.5 4 838.0 4,456.34 0.00027821 2.95 1.48 240 151 255.7 4 1,022.8 5,439.07 0.00033956 3.07 1.53 270 159 176.5 4 706.0 3,754.38 0.00023439 2.23 1.12 300 174 217.2 4 868.8 4,620.12 0.00028843 3.01 1.51 330 174 204.7 4 818.8 4,354.23 0.00027183 2.83 1.42 360 200 177.8 4 711.2 3,782.04 0.00023611 2.83 1.42 390 184 318.4 4 1,273.6 6,772.78 0.00042282 4.67 2.34 420 135 327.2 4 1,308.8 6,959.97 0.00043451 3.52 1.76 450 159 305.1 4 1,220.4 6,489.87 0.00040516 3.87 1.93 480 157 311.1 4 1,244.4 6,617.50 0.00041313 3.89 1.95 Averages 165 218.7 4 874.9 4,652.74 0.00029047 2.95 1.22 Total emissions (gal):4.09 Total emissions (lbs):25.56 NOTES PPM measured = Actual measurements (ppm) taken with a OVA or TVA at the blower discharge piping K = Number of carbons in calibration gas: (Methane K = 1, or Propane K = 3, or Hexane K = 6) PPMg = PPMv, Volumetric concentration as gasoline emission, dry basis at STP Cg:m = mg/dsm3, mass concentration of gasoline emission Mg = 128 mg/mg-mole, molecular weight of gasoline (this value may vary depending on contaminant) K3 = 24.07 dsm^3/1E6 mg-mole, mass to volume conversion factor at STP Cg = lb/dcsf, mass concentration of gasoline emission, dry basis at STP PMRg = lb/hr, pollutant mass removal rate of gasoline emission PMR = pollutant mass removal of gasoline emission over time EQUATIONS PPMg = PPM measured * K Cg:m = PPMg * (Mg / K3) Cg = Cg:m * 62.43E-09 lb-m^3/mg-ft^3 PMRg = Cg * Qstd * 60 min/hr PMR = PMRg * ((T2 - T1) / 60) Total emmissions (gal) = Total emmissions (lbs)/6.25 Page 2 of 2 APPENDIX D Liquid Disposal Manifest