Loading...
The URL can be used to link to this page
Your browser does not support the video tag.
Home
My WebLink
About
MO-7773_36396_CA_CAPR_20230913
Speedway, LLC 500 Speedway Drive Enon, Ohio 45323 Phone: (919) 516-8069 Corrective Action Performance Report Speedway Store No. 7971 1343 Rock Barn Road Conover, Catawba County, North Carolina Incident No. 36396 Project No. 60690569 September 5, 2023 AECOM ii Speedway 7971 Conover, NCCorrective Action Performance Report September 2023 Quality Information Prepared by Reviewed by Erik Riegel Environmental Scientist Erik.Riegel@aecom.com Brett G. Schaefer, PE Project Manager Brett.Schaefer@aecom.com Reviewed by Marie Treiber Regional Senior Project Manager Marie.Treiber@aecom.com Prepared for: Speedway, LLC 500 Speedway Drive Enon, Ohio 45323 Phone: (937) 864-3000 Prepared by: AECOM Technical Services of North Carolina, Inc. 6000 Fairview Road, Suite 200 Charlotte, North Carolina 28210 Phone: (704) 522-0330 aecom.com Copyright © 2023 by AECOM All rights reserved. No part of this copyrighted work may be reproduced, distributed, or transmitted in any form or by any means without the prior written permission of AECOM. AECOM iii Speedway 7971 Conover, NCCorrective Action Performance Report September 2023 Professional Certification Page I, Brett G. Schaefer, a Licensed Engineer for AECOM Technical Services of North Carolina, Inc., do certify that the information contained in this report is correct and accurate to the best of my knowledge. _________________________________ Brett G. Schaefer, PE AECOM Technical Services of North Carolina, Inc. AECOM Technical Services of North Carolina, Inc. is licensed to practice engineering in North Carolina. The certification number of the company or corporation is F-0458. AECOM iv Speedway 7971 Conover, NCCorrective Action Performance Report September 2023 Table of Contents 1 Introduction .................................................................................................................................................. 1 2 Site Background Information......................................................................................................................... 2 2.1 Site Identification ............................................................................................................................... 2 2.2 Contact Information ........................................................................................................................... 2 2.3 Information about the Release ........................................................................................................... 2 3 Site History and Characterization .................................................................................................................. 4 3.1 Underground Storage Tank Systems .................................................................................................. 4 3.2 Aboveground Storage Tank Systems.................................................................................................. 4 3.3 Historical Releases ............................................................................................................................ 4 3.4 Site Characteristics ........................................................................................................................... 4 3.4.1 Zoning/Receptor Information ................................................................................................... 4 3.4.2 Site Geology and Hydrogeology .............................................................................................. 4 4 Receptor Information .................................................................................................................................... 5 4.1 Water Supply Wells ........................................................................................................................... 5 4.1.1 Private Water Supply Wells ..................................................................................................... 5 4.1.2 Public Water Systems ............................................................................................................. 5 4.2 Surface Water ................................................................................................................................... 5 4.3 Wellhead Protection Areas ................................................................................................................. 5 5 Treatment System Operation and Maintenance ............................................................................................. 6 5.1 System Restart and Treatment System Modifications ......................................................................... 7 5.1.1 Timeline Details ...................................................................................................................... 7 5.2 System Restart.................................................................................................................................. 9 6 Effluent Sample Results ............................................................................................................................. 10 6.1 Air Stack ......................................................................................................................................... 10 6.2 NPDES Discharge ........................................................................................................................... 10 7 Remedial System Operations Summary .......................................................................................................11 7.1 O&M Site Visits ................................................................................................................................11 7.2 Treatment System Operational Data .................................................................................................11 7.3 Mass of Contaminant Removed ........................................................................................................11 7.3.1 Mass Removed as Vapor .......................................................................................................11 7.3.2 Mass Removed as Liquid ...................................................................................................... 12 8 CONCLUSIONS AND RECOMMENDATIONS ............................................................................................ 12 9 References ................................................................................................................................................ 13 AECOM v Speedway 7971 Conover, NCCorrective Action Performance Report September 2023 Figures Figure 1 :Site Location Map Figure 2 :Site Plan Tables Table 1 :Remediation System Air Stack Effluent Samples Table 2 :Remediation System Effluent Water Samples Table 3 :DPE System Total BTEX Removal Calculations Appendices Appendix A:O&M Field Logs Appendix B:Laboratory Analytical Reports AECOM 1 Speedway 7971 Conover, NCCorrective Action Performance Report September 2023 1 Introduction As required by the NCDEQ, AECOM Technical Services of North Carolina, Inc. (AECOM) on behalf of Speedway LLC (Speedway) has prepared this Groundwater Monitoring Report for Speedway Store No. 7971 (Site), located at 1343 Rock Barn Road, Conover, Catawba County, North Carolina. The site is currently in use as a truck stop, convenience store and retail petroleum dispensing facility, and operates two 20,000-gallon diesel fuel underground storage tanks (USTs), one 12,000-gallon regular unleaded gasoline UST, and one 10,000-gallon premium unleaded gasoline UST. There are two separate releases (gasoline and diesel fuel) associated with this facility. The gasoline release was reported in September 2007 and the diesel fuel release was reported in January 2010. A Corrective Action Plan (CAP) proposing air sparge/ vapor extraction (AS/VE) for the gasoline release was prepared in October 2009 and implemented thereafter but did not address the diesel fuel release since the release had not been discovered at that time. An initial New Technology Cleanup Plan (NTCP) proposing mobile multi-phase extraction (MMPE) in conjunction with monitored natural attenuation (MNA) of groundwater was prepared and approved for the diesel fuel release in August 2010. A total of twenty-four MMPE events were conducted at the site following approval of the NTCP, with several of the event times split between the diesel fuel and gasoline release areas. The North Carolina State Trust Fund then indicated that the total costs of MMPE events had approached the purchase price of a dual phase extraction (DPE) system and, therefore, the Trust Fund would no longer authorize additional rental costs. As a result, a subsequent NTCP was prepared and approved for the installation of a mobile DPE system to address both the gasoline and diesel fuel releases. A mobile DPE system was installed at the site and started for the first time on November 2, 2018, to address both the gasoline and diesel fuel releases. In July 2022, AECOM took over remediation responsibilities for the Site and began procedures for restarting the system. In November 2022 the DPE system was restarted, and regular Operation and Maintenance (O&M) activities were performed by AECOM staff. This Corrective Action Performance Report (CAPR) documents the remedial system restart, system operations (O&M), extraction well installation and supply chain delivery issues during the period from November 2022 through August 2023. This report is based on limited observations made on the dates noted using the procedures described herein. AECOM 2 Speedway 7971 Conover, NCCorrective Action Performance Report September 2023 2 Site Background Information The following sections provide site background and contact information. 2.1 Site Identification – Date of Incident Report:September 20, 2007 – Facility ID: 0-034426 Incident Number: 36396 – Site Rank:High – Site Name:Speedway Store No. 7971 – Site Street Address:1343 Rock Barn Road – City/Town: Conover Zip Code: 28613 County: Catawba – Description of Geographical Data Point (e.g., dispenser): Site Property – Location Method (global positioning system, topographical map, other): Google Earth – Latitude (decimal degrees): 35.7213 °, Longitude (decimal degrees): -81.1893 ° 2.2 Contact Information – UST Owner: Speedway LLC. Address: 500 Speedway Drive, Enon, Ohio 45323 Telephone: (937) 864-3000 – UST Operator: Speedway LLC. Address: 500 Speedway Drive, Enon, Ohio 45323 Telephone: (937) 864-3000 – Property Owner: PFJ Southeast LLC. Address: PO Box 54710, Lexington, Kentucky 40555 Telephone: (865) 474-2826 – Property Occupant: PFJ Southeast LLC. Address: PO Box 54710, Lexington, Kentucky 40555 Telephone: (865) 474-2826 Consultant/Contractor: AECOM Address: 6000 Fairview Road, Suite 200, Charlotte, North Carolina 28210 Telephone: (704) 522-0330 – Analytical Laboratory: Pace Analytical State Certification No. 5342 Address: 9800 Kincey Avenue, Suite 100, Huntersville, North Carolina 28078 Telephone: (704) 875-9092 2.3 Information about the Release On September 20, 2007, gasoline was observed leaking from an unleaded gasoline line within a containment sump during a routine compliance inspection. The damaged line was repaired and WilcoHess (owner/operator at the time) replaced all UST containment sumps, underground product lines and dispenser sumps. A 24-hour Release and UST Leak Reporting Form was submitted to the NCDEQ, Division of Waste Management (DWM), UST Section, WSRO on September 20, 2007, and the site was assigned incident number 36396. In January 2010, diesel fuel LNAPL was detected for the first time in monitoring well MW-3, which is located near the truck diesel fuel dispensers. Since then, the extent of the diesel fuel LNAPL plume has expanded to include several additional monitoring wells. AECOM 3 Speedway 7971 Conover, NCCorrective Action Performance Report September 2023 On July 6, 2020, Pilot (the current operator of the store) reported a release of diesel fuel from Dispenser #18 to NCDEQ. LNAPL was present in the under-dispenser containment (UDC) and it was determined that the source of the fuel was a leaking meter. The UDC did not pass subsequent hydrostatic testing. It is un-known how long the meter was leaking, but NCDEQ has determined that this release is considered commingled with the existing diesel release, Incident number 36396. AECOM 4 Speedway 7971 Conover, NCCorrective Action Performance Report September 2023 3 Site History and Characterization The following sections provide information on the USTs operated at the Site and follows the general outline established in UST Section Assessment Guidelines (NCDEQ, 2021a), UST Section Corrective Action Guidelines (NCDEQ, 2021b) and Guidelines for Site Checks, Tank Closure, and Initial Response and Abatement for UST Releases (NCDEQ, 2021c) using the Comprehensive Tables for Corrective Action Guidelines Tables (NCDEQ, 2022). 3.1 Underground Storage Tank Systems UST owner operator and other responsible party information are provided in Table 1. A summary of current and former USTs maintained at the Site is provided below and summarized in Table 2. According to the Catawba County, North Carolina Geographic Information System (GIS) mapping service, the current property owner of the subject site is listed as PFJ Southeast LLC. On October 1, 2014, Speedway purchased the site from WilcoHess. 3.2 Aboveground Storage Tank Systems No aboveground storage tank systems (ASTs) are currently present on site. Based on available information, no ASTs have historically been present at the Site. 3.3 Historical Releases No information on releases other than Incident 36396 is available for this Site. 3.4 Site Characteristics The location of the Site is shown on a portion of the United States Geological Survey (USGS), Topo USGS 7.5 Minute Topographic: Newton, NC (2019) digital raster graphic file (Figure 1). The layout of the Site is found on Figure 2. The Site is currently operational. The Site is occupied by a PFJ convenience store with Speedway gasoline operations. The site is located at 1343 Rock Barn Road, Conover, North Carolina and is accessed from Rock Barn Road, located Southeast of the site. Various commercial and residential properties surround the Site. 3.4.1 Zoning/Receptor Information The Site and adjoining properties are currently zoned Residential and business (Catawba GIS Viewer). Receptor information for the site was documented in Mid-Atlantic Associates Inc (Mid-Atlantic)’s (Speedway’s former consultant) May 15, 2008, Phase II Limited Site Assessment (LSA) Report and amended in Mid-Atlantic’s CAP dated October 8, 2009. A receptor survey update was not completed for this phase of work. For additional details, please refer to the LSA report and CAP report. 3.4.2 Site Geology and Hydrogeology Site geology was evaluated based on historic (Mid-Atlantic) and current investigations. The site is located within the interlayered rocks of the Carolina Inner Piedmont Belt. The site appears to be in a predominantly metamorphic rock formation described as “Metamorphosed’. In general, the soils encountered at the Site consist of reddish-brown, light brown, reddish-orange and black silty clays, and clayey silts, generally getting coarser-grained with depth in the first sixty feet and then become partially weathered rock and bedrock at approximately eighty feet. Based on the results of the June 2023 gauging event, groundwater flow is to the north, which is generally consistent with historical groundwater flow. AECOM 5 Speedway 7971Conover, NC Corrective Action Performance Report September 2023 4 Receptor Information 4.1 Water Supply Wells The previous consultant (Mid Atlantic) conducted a water supply well survey in 2008 to identify the presence of water supply wells within a 1,500-foot radius from the Site and is documented in Mid-Atlantic’s May 15, 2008, Phase II LSA Report and amended in Mid-Atlantic’s October 8, 2009, CAP. 4.1.1 Private Water Supply Wells It was confirmed that two water supply wells are present within 205 feet of the source areas of the releases, one used for drinking (user has municipal connection used for everything but drinking water), and one reportedly not in use. Seven wells were identified between 250 and 1,000, one for drinking, three used for irrigation or cleaning, and three not in use. And five wells were identified between 1,000 and 1,500 feet of the source areas three of unknown use, one for drinking, and one for irrigation. For additional details, please refer to the LSA report and CAP report. 4.1.2 Public Water Systems The Site obtains water from the Conover’s municipal water-supply system, which purchases water from the City of Hickory drawing water from Lake Hickory on the Catawba River (Conover, 2021). Based on currently available information, the properties surrounding the Site receive their municipal water supplies through buried piping that runs beneath the streets and highway easements. A portion of Banner Road according to Conover’s public works department do not receive service after where the line ended at 102 Banner Road. 4.2 Surface Water No surface water was observed on the Site. The nearest off-site surface water is an unnamed tributary of Mull Creek located approximately 1,300 feet to the southwest of the Site. However, drainage from the site appears to be to generally to the northwest towards an unnamed tributary of Lyle Creek. This unnamed tributary is located approximately 2,200 feet north of the source area of the release. 4.3 Wellhead Protection Areas According to the NCDEQ Well Head Protection website, last updated in July 2022, there are no approved wellhead protection plans located in Catawba County. AECOM 6 Speedway 7971Conover, NC Corrective Action Performance Report September 2023 5 Treatment System Operation and Maintenance The following tasks were performed for the reporting period of performance of November 2022 through August 2023: •Restart remediation system •Cleanout of all sight glasses and level switch contacts of encrusted bio-fouling, and adjustments to valves to control the flow rate; •Inspect and repair pumps and liquid level controls as needed; •Tweaked float controls and valve settings as needed; •Assessed cleanliness of equipment -clean and wipe down as necessary; •Recorded run time hours; •Recorded flow meter readings for effluent discharge; •Evaluated condition of the DPE system (i.e., air filters, particulate filter, etc); and •Changed oil, filters and belts as needed. Additional operational data, site visit notes and photographs are available in the O&M Field Logs provided in Appendix A. AECOM 7 Speedway 7971Conover, NC Corrective Action Performance Report September 2023 5.1 System Restart and Treatment System Modifications 5.1.1 Timeline Details Date Description 11/17/2022 Attempted to turn system on. System did not start up immediately. Applied penetrating oil on blower parts to break blower free from corrosion. Checked blower rotation and all filter housings. Restarted system and observed operation until noticed that the HHL alarm caused system shutdown. Moisture separator pump was not keeping up with vacuum. It was determined a new moisture separator pump is required. Took system readings left system off to re-evaluate operation. 11/29/2022 Installed new M/S pump. Restarted system. Collected readings. Fine-tuned system for continuous operation after new pump was installed. Restarted system, collected readings, and left site with system operating. 12/9/2022 Site visit to collect system readings; adjusted valves as necessary to maintain proper vacuum levels. 12/15/2022 Site visit to collect system readings; adjusted valves as necessary to maintain proper vacuum levels. Collected effluent air and water samples. 12/20/2022 System was off upon arrival. Reset alarms, restarted system, and collected readings.Adjusted valves and pressure gauges. System on upon departure. 12/27/2022 Site visit to check on system during freezing weather. System was operating as normal. Collected system readings. Left site operating. 1/31/2023 Site Visit; collected monthly air stack discharge sample. Collected system readings and checks. 2/1/2023 Site Visit: collected system readings. 2/9/2023 Site visit: Set up portable pump and hose to pump excess water from the product holding tank into the system influent tank for treatment and disposal to sewer. Pumped approx. 2/3 of contents of to the influent tank. AECOM 8 Speedway 7971 Conover, NCCorrective Action Performance Report September 2023 Date Description 3/27/2023 Site visit: Installed a ball valve on the line between the influent tank and the oil/water separator. Replaced the leaking vacuum breaker valve on effluent discharge line. Collected monthly air effluent sample. Collected quarterly water effluent sample. 4/5/2023 Pumped out the water from the product storage tank into the main tank for treatment. Changed out bag filter. OWS separator was starting to flood again. Shut off flow to the tank and let the levels normalize with the aeration tank and slowly feed more water through the system. System operating upon departure. 4/24/2023 System down upon arrival; OWS separator was flooded, MS Level was High-high alarm, and the product tank is flooded. Pumped product tank into the main equalization tank and pumped the MS to the equalization tank. Slowly fed the OWS from the EQ tank. Left the vac pump offline until the system levels returned to normal operating levels. Closed the OWS feed valve to 50% to prevent potential flooding. Did not collect monthly air discharge sample due to system operating issues. 5/22/2023 System off upon arrival due to vacuum alarm and the OWS pump not turning on. Replaced the following system components: Vacuum sensor, OWS float tree. Pumped water from product tank to system for treatment. Changed bag filter, changed vacuum filter. Cleared alarms and restarted system. Observed operation and adjusted vac and flows for optimal operation. System operating upon departure. 6/8/2023 System was down upon arrival. High Level alarms in the OWS and MS. Ran the pumps in manual to clear the alarms, pumped the product recovery tank which flooded when the OWS gets a High-High Alarm. Tested the float tree switch for the OWS, it is not activating the OWS transfer pump properly. The float switch was replaced 2 weeks prior to this visit. System operated properly as of 2 weeks ago. Will try to replace new float tree to rule out equipment failure and see if it is an electrical problem. GAC vessels require change outs. 6/14/2023 Worked on getting the OWS float switch to activate the OWS transfer pump. Checked all of the switch wiring connections, in-line and the control panel. Tightened everything and tested float. Pump activated. Restart system to observe operation. During observation the OWS transfer pump operated two times properly and on the third time it failed to activate the pump. Possible issue at the panel beyond tech’s capabilities. System was left off upon departure. 6/20/2023 Site visit; collected effluent water sample. Collected effluent air stack sample; collected system readings. 7/24/2023 Site visit; general observation: system does not run consistently potentially due to wiring issues at the panel. The OWS switch signal operates periodically. Attempted to restart the system but could not keep it operating due to the High-High level alarms. System could not stay on long enough to collect proper readings and collect monthly effluent samples. AECOM 9 Speedway 7971 Conover, NCCorrective Action Performance Report September 2023 5.2 System Restart As summarized in the Timeline Details section of this report (Section 5.1.1), the treatment system was restarted on November 29, 2022. The remediation system had operated without much issue until April 2023. System components were changed out due to age and the system had been operating periodically. Based on observations with the system operation there may be wiring issues connected to the main control panel and the Oil/Water separator (OWS) float switch. When the float switch fails to operate the system shuts down and causes cascading alarms and potentially floods the OWS. The system is also in need of a full cleaning. At the time of this report (August 2023) the system is not operating and waiting on a schedule date for a deep cleaning with a subcontractor. Since system restart on November 29, 2022, the system has suffered multiple shutdowns. A calculated runtime of 52% was recorded during this reporting period. The below graph summarizes the system performance based on system logs acquired through the remote login program. AECOM 10 Speedway 7971 Conover, NCCorrective Action Performance Report September 2023 6 Effluent Sample Results 6.1 Air Stack Sampling of the DPE effluent stack was performed on December 15, 2022, January 31, 2023, March 27, 2023, and June 20, 2023, during the current reporting period (November 2022 through August 2023). Samples were shipped under chain-of-custody control to Pace Analytical in Mt. Juliet, Tennessee for analysis of BTEX according to EPA Method 18. A copy of the laboratory analytical reports and chain-of-custody records for the effluent stack samples are provided in Appendix B, with the results summarized in Table 1. As summarized, BTEX compounds were detected in all effluent stack samples collected during this reporting period. 6.2 NPDES Discharge Liquid discharge samples were collected from the DPE treatment system on December 15, 2022, March 27, 2023, and June 20, 2023, during this current reporting period (November 2022 through August 2023). Samples were shipped under chain-of-custody control to Pace Analytical Services in Charlotte, North Carolina for total suspended solids by SM2540D-2015, phenols by EPA Method 420.1, oil & grease according to EPA Method 1664B, BTEX by EPA Method 8260D, and lead by EPA Method 6020B. A copy of the laboratory analytical reports and chain-of-custody records for the effluent stack samples are provided in Appendix B, with the results summarized in Table 2. AECOM 11 7 Remedial System Operations Summary 7.1 O&M Site Visits O&M site visits (including extraction well installation visits) were conducted on the following dates during the reporting period: 7.2 Treatment System Operational Data Claw pump run hours and water meter totalizer readings obtained during O&M site visits are provided below: 7.3 Mass of Contaminant Removed 7.3.1 Mass Removed as Vapor Calculations of petroleum hydrocarbon mass removed as vapor were performed using the air stack samples collected on December 15, 2022, January 31, 2023, March 27, 2023, and June 20, 2023. Based on the mass removal calculations, Total BTEX removed by operation of the remediation system during this reporting period was 0.16 lbs as vapor. Mass removal calculations are provided as Table 3. Date Date 11/17/2022 3/27/2023 11/29/2022 4/5/2023 12/9/2022 4/24/2023 12/15/2022 5/22/2023 12/20/2022 6/8/2023 12/27/2022 6/14/2023 1/31/2023 6/20/2023 2/1/2023 7/24/2023 2/9/2023 Date LRP Run Hours Water Meter Reading (gal) 11/17/2022 10765 389296 11/29/2022 10767 389344 12/9/2022 10944 399406 12/15/2022 10962 399808 12/20/2022 11057 404612 12/27/2022 11230 410008 2/1/2023 11769.9 426615.67 3/27/2023 12420.1 459720.63 4/24/2023 -482976.20 6/20/2023 13383.8 506157.39 AECOM 12 7.3.2 Mass Removed as Liquid For the reporting period, approximately 116,861.39 gallons of petroleum-impacted groundwater was treated by the remediation system. Since the EQ tank was installed, no additional free product has been recovered in the treatment system's original product tank. 8 CONCLUSIONS AND RECOMMENDATIONS Based on our observations and activities conducted over the current reporting period, AECOM concludes the following: •A total of 116,861.39 gallons gallons of water were extracted from the DPE treatment system during the period of performance. •The treatment system has operated at an average runtime of 52% during this reporting period. •Approximately 0.16 pounds of total BTEX was removed as vapor measured via the air stack effluent at the claw pump. •The DPE system currently remains off due to required cleaning of components and a potential electrical system problem causing the OWS float switch to fail to activate properly. This error causes the OWS to overflow into the equalization tank used to collect product. •The electrical system requires an evaluation by an electrician to determine if the PLC at the main control panel or a wiring issue with the float switch is the cause of pump operation failures. In lieu of the poor DPE system performance and lack of LNAPL recovery, a Mobile Multiphase Extraction (MMPE) event was scheduled for September 18 through 22, 2023 to target monitoring wells with significant apparent LNAPL thicknesses. LNAPL recovery from the event may warrant re-evaluation of the need to continue DPE system operation or modify the existing system for better performance and LNAPL recovery. Based on these conclusions, AECOM on behalf of Speedway, recommends the following: •Keep the DPE system shut down for 6 months (October 2023 through April 2024). •Perform a deep cleaning of the DPE system during the shutdown period. •Evaluate electrical components during the shutdown period. •Continue groundwater sampling on a semi-annual basis. •Perform and evaluate the September 2023 MMPE event and LNAPL recovery. •Submittal of this report to the NCDEQ UST Section. AECOM 13 9 References NCDEQ, 2021a. UST Section Assessment Guidelines. effective January 19, 2021. NCDEQ, 2021b. UST Section Corrective Action Guidelines. effective January 19, 2021. NCDEQ, 2021c. Guidelines for Site Checks, Tank Closure, and Initial Response and Abatement for UST Releases. Change 11, effective May 17, 2021. NCDEQ, 2022. Comprehensive Tables for Corrective Action Guidelines Tables. Effective September 7, 2022. Mid-Atlantic Associates, 2008. Phase II LSA Report. May 15, 2008. Mid-Atlantic Associates, 2018. Corrective Action Plan. September 25, 2018. Mid-Atlantic Associates, 2022. Groundwater Monitoring Report. February 27, 2022. Conover, 2021. 2021 Annual Drinking Water Quality Report, City of Conover, https://www.conovernc.gov/vertical/sites/%7BBAB0D760-E669-4331-9C22- 9FB14833B6B9%7D/uploads/2021_Annual_Drinking_Water_Quality_Report_-_____.pdf, accessed September 29, 2022. Figures 2,0002,000 N SITE LOCATION I. DUMITRUAUGUST 2023 SITE LOCATION MAP FIGURE 1 Source: Topo USGS 7.5 Minute Topographic Map Quadrangle: Newton, NC Copyright: 2019 National Geographic Society DATE:DRAWN BY:REVIEWED BY:PROJECT NO.:File: \\na.aecomnet.com\LFS\AMER\Chelmsford-USCHL1\Secure_DCS\Projects\Legacy\711\North Carolina\47293-7971 Conover\60690569\Section 5.0 Reports\Reports\PATA-69_GWMR_2023 07 July_Report\Figures\47293-7971 Conover_2023 07 July_Report.dwg Layout: Figure 1 Date: 21 Aug, 2023 Xrefs:00 SCALE IN FEET: NOTE: ALL MAP FEATURES ARE APPROXIMATE IN SCALE AND LOCATION. E. RIEGEL Speedway Store #7971 1343 Rock Barn Road Conover, North Carolina 60690569 Speedway LLC. SpeedwayStore #7971R o c k B a r n R o a d N o r t h e a s tTank FieldVent PipesDiesel Canopy& Pump IslandsGasoline Canopy& Pump IslandsCAT ScaleConcrete PadConcrete PadFormerPumpIslandTruck ParkingMW-6MW-24MW-23RMW-21MW-20MW-19MW-18MW-22MW-26MW-27MW-28MW-17MW-16MW-9MW-10DMW-2MW-13MW-8MW-14RMW-11DMW-7MW-12MW-5MW-4MW-4MW-3RMW-25MW-1RMW-6MW-15VE-OW-2SCALE IN FEET:40400DATE:DRAWN BY:REVIEWED BY:PROJECT NO.:\\na.aecomnet.com\LFS\AMER\Chelmsford-USCHL1\Secure_DCS\Projects\Legacy\711\North Carolina\47293-7971 Conover\60690569\Section 5.0 Reports\Reports\PATA-69_GWMR_2023 07 July_Report\Figures\47293-7971 Conover_2023 07 July_Report.dwg, 8/21/2023 12:52 PM, Schaefer, Brett, PDF995.pc3, User32767, 1'-0" = 1'-0"NI. DUMITRUE. RIEGELFIGURE 2SITE PLANLEGENDNOTE: ALL MAP FEATURES ARE APPROXIMATEIN SCALE AND LOCATION.Speedway Store #79711343 Rock Barn RoadConover, North Carolina60690569Speedway LLC.Approximate Property BoundaryFenceProduct Dispenser#1, #2#3#4Underground Storage Tank20,000-Gal. Diesel USTs12,000-Gal. RUL Gasoline UST10,000-Gal. PUL Gasoline USTProduct PipingOverhead WireBuried Electric LineBuried Telephone LineWater LineSanitary SewerUtility Pole / Power PoleLight Post / Traffic LightFire HydrantMonitoring WellVapor Extraction Pilot Test WellMonitoring Well (Deep)Recovery WellAUGUST 2023 Tables Air Stack Effluent 12/15/22 3,930 23,900 3,460 12,300 5,220 Air Stack Effluent 01/31/23 3,420 15,300 2,640 10,000 5,030 Air Stack Effluent 03/27/23 6,010 26,400 11,700 27,200 12,800 Air Stack Effluent 06/20/23 7,220 38,400 5,770 21,900 10,300 Notes: ND - Not detected at or above laboratory's practical quantitation limit NA - Not Analyzed for this parameter All concentrations reported in ug/L - micrograms per liter except where otherwise noted m&p- Xylene o-Xylene TABLE 1 REMEDIATION SYSTEM AIR STACK EFFLUENT SAMPLES SPEEDWAY 7971 CONOVER, NORTH CAROLINA INCIDENT NO. 36396 Sample Date Toluene EthylbenzeneBenzeneWell Number Conover Eflfuent 12/15/22 ND ND ND ND ND 2.2 0.054 ND ND Conover Eflfuent 03/27/23 ND ND ND ND ND ND ND NA ND Conover Eflfuent 06/20/23 NA NA NA NA NA ND ND NA 2.5 Notes: ND - Not detected at or above laboratory's practical quantitation limit NA - Not Analyzed for this parameter All concentrations reported in ug/L - micrograms per liter except where otherwise noted Leadm&p- Xylene o-Xylene Phenol (mg/L) Total Suspended Solids (mg/L) Oil & Grease (mg/L) TABLE 2 REMEDIATION SYSTEM EFFLUENT WATER SAMPLES SPEEDWAY 7971 CONOVER, NORTH CAROLINA INCIDENT NO. 36396 Well Number Sample Date Benzene Toluene Ethylbenzene Conversion Factor3 Total BTEX Mass Removal per Sample4 (lb-m3/mg-ft3)(lb. recovered per sample) 12/15/22 Air Stack Effluent 10962.0 195 15 48.81 6.243E-08 0.009 01/31/23 Air Stack Effluent 11769.9 807.9 15 36.39 6.243E-08 0.028 03/27/23 Air Stack Effluent 12420.1 650.2 15 84.11 6.243E-08 0.051 06/20/23 Air Stack Effluent 13383.8 964 15 83.59 6.243E-08 0.075 Average Airflow:15 Total Recovered Total BTEX (lb):0.16 Notes: 5. Sample collected on 12/15/2022 was first sample collected after system restart by AECOM on 11/29/22. LRP Hour Meter Reading (min) 1. Air flow rates were extrapolated using system vacuum readings from system main panel. 2. Total BTEX concentrations in the exhaust are based on analytical data collected during site visits. 3. Conversion factor to convert units of concentration from mg/m3 to lb/ft3. 4. Mass removal rate (lb) = (air flow rate) x (Total BTEX Conc.) x (conversion factor) x (elapsed operating time). TABLE 3 DPE SYSTEM TOTAL BTEX REMOVAL CALCULATIONS SPEEDWAY 7971 - CONOVER Sample Date Air Sample ID Elapsed Operating Time Between Samples (min)5 Air Flow Rate1 (ft3/min)Total BTEX(mg/m3) Appendix A O&M Field Logs Site Name:Personnel: Date: Arrival Departure On / Off On / Off "Hg °F "H2O PSI "H2O PSI Gallons Remediation System Operation & Maintenance Inspect entire system for loose bolts, loose connections, broken components, rust, clogging, or leakage: Project Number: Departure Time: Dual Phase Extraction System Aerator Pump Hour Meter: Arrival Time: Repair above issues: MS Vapor Temperature Aerator Influent Pressure Vacuum Blower Hour Meter:MS Pump Hour Meter: OWS Pump Hour Meter:Aerator Blower Hour Meter: Aerator Discharge Pressure Effluent Flow Totalizer: Influent MS Vacuum: Page 1 of 2 Date:Site Name: Log/Notes: Page 2 of 2 Daily Work Log Page____ of ____ Date:Client: Project Number: Weather & Site Conditions: Equipment: Personnel Onsite: Tailgate Safety Meeting Notes: Instruments & Calibration: Work Log & Notes: Daily Objective: Time Onsite:Time Offsite: Project Name:Project Location: Field Personnel: Project Manager: Daily Work Log Page____ of ____ Date:Project Number: Site Name:Personnel: Date: Arrival Departure On / Off On / Off "Hg °F "Hg "H2O PSI "H2O PSI Gallons %% Inches DP Vacuum Blower Discharge LEL:Room LEL: Product Tank Level: Remediation System Operation & Maintenance Inspect entire system for loose bolts, loose connections, broken components, rust, clogging, or leakage: Project Number: Departure Time: Dual Phase Extraction System Aerator Pump Hour Meter: Arrival Time: Repair above issues: MS Vapor Temperature Aerator Influent Pressure Effluent Moisture Separator Vacuum: Vacuum Blower Hour Meter:MS Pump Hour Meter: OWS Pump Hour Meter:Aerator Blower Hour Meter: Aerator Discharge Pressure Effluent Flow Totalizer: Influent Moisture Separator Vacuum: Page 1 of 2 SpeedwayConover TimDickey 3127123 60690569 0730 1400 O O 12420.1 1215.4 437.3 17448.4 4454.4 15.5 215 15.5 38 13.5 7 0.25 459720.63 O O Full Date:Site Name: Log/Notes: Page 2 of 2 3 27 23 SpeedwayConover CompletedSafetyReview Installed a ballvalve inthelinebetweentheinfluenttankandows Replacedthevacuumbreakervalveintheeffluentdischargeline wasleaking Replacedthevacuumbreakervalvebetweentheowsandtheaeratortank wasleaking Tried topumpouttheproducttank theportabletransferpumpquitorderedanewpump Collectedthemonthly aireffluentsample ConoverAirStack Eff Collected thequarterlywatereffluentsample ConoverEffluent Daily Work Log Page____ of ____ Date:Client: Project Number: Weather & Site Conditions: Equipment: Personnel Onsite: Tailgate Safety Meeting Notes: Instruments & Calibration: Work Log & Notes: Daily Objective: Time Onsite:Time Offsite: Project Name:Project Location: Field Personnel: Project Manager: I I 4 5 23 Speedway SpeedwayConover TimDickey ConoverNC BrettSchaefer 60690569 Pumpwateroutoftheproductstoragetankandsendwaterbackthroughthesystemfortreatment 0830 1530 Verywarmandhumid Portabletransferpump NA Reviewedsafetyprocedures NA Setuptransferpumpandpumped thewaterFromtheproductstoragetankintothemaintankfortreatment ChangedoutthebagfilterOilWaterseparatorwasbeginningtofloodagain shutoff flowto it andletthe levelsin itandtheaerationtanknormalizeandslowlyfeedmorewaterthroughthe system 1500 system'soperatingnormallyagain Daily Work Log Page____ of ____ Date:Project Number: Daily Work Log Page____ of ____ Date:Client: Project Number: Weather & Site Conditions: Equipment: Personnel Onsite: Tailgate Safety Meeting Notes: Instruments & Calibration: Work Log & Notes: Daily Objective: Time Onsite:Time Offsite: Project Name:Project Location: Field Personnel: Project Manager: I I 4 24 23 Speedway Conover ConoverNC TimDickey B Schaefer 60690569 MonthlyOM 0830 1620 Clearcooltowarm NA NA ReviewsafetyproceduresandreviewHASP NA systemisdown oilwaterseparatorisfloodedMslevelisHighHighalarmandtheproducttankis floodedPumpeddowntheoilwatersepinstagestonotoverwhelmtheAerationtank PumpedtheproducttankintothemainEqualizationtankandpumpedtheMstotheEqualizationtank SlowlyFeedtheonsepfromtheEqualizationtank LeavethevacuumPumpofflineuntilsystemlevelsreturntonormaloperatinglevels SpokewiththeprojectmanageraboutcleanthesystemtokeepfromgettingHighlevelsandfloodingandshutingdown keepslowlyfeedingthewaterthroughthesystem ClosedthevalvetotheowsepFromtheEqTank toapprox50 totrytokeeptheowSepFromFlooding TheONSepFloatswitchesmaynotbeoperatingastheyshouldCleanedthefloattreewillhavetoobserve operationtodetermineiftheyneedtobereplaced Didnotcollectamonthlyairdischargesampleduetosystemoperationissues WaterDishargeMeterreading 482,976 20gallons Daily Work Log Page____ of ____ Date:Project Number: Daily Work Log Page____ of ____ Date:Client: Project Number: Weather & Site Conditions: Equipment: Personnel Onsite: Tailgate Safety Meeting Notes: Instruments & Calibration: Work Log & Notes: Daily Objective: Time Onsite:Time Offsite: Project Name:Project Location: Field Personnel: Project Manager: I 1 5122123 Speedway SpeedwayConover 7971 ConoverNC TimDickey BrettSchaefer 60690569 Repairandrestartthesystem 0845 Overcastwarmhumid n NA completedsafetychecksandsafetyproceduresreview NA Thesystemisofflineduetovacuumalarmandtheowspumpnotcomingon ReplacedthevacuumsensorTransmitter Ok ReplacedtheOwsfloattreeok PumpedtheProductTankFullofwaterintothesystemprocesstankfortreatment Chargedoutthebagfilter Changedoutthevacuumblowerfilter RestartedthesystemVacuumAlarmhasclearedOwspumpisnowcomingonwhenit issupposedto Observedoperationand adjustedvacuumandflowsforoptimaloperations Thesystemseemstobeoperatingwellnow Daily Work Log Page____ of ____ Date:Project Number: Daily Work Log Page____ of ____ Date:Client: Project Number: Weather & Site Conditions: Equipment: Personnel Onsite: Tailgate Safety Meeting Notes: Instruments & Calibration: Work Log & Notes: Daily Objective: Time Onsite:Time Offsite: Project Name:Project Location: Field Personnel: Project Manager: I I 6 8 23 Speedway SpeedwayConover Conover NC TimDickey BrettSchaefer 60690569 TroubleshootandrestarttheDPEsystem 0730 1430 HazyHumidHot NA NA ReviewedSafetyProcedures NA Thesystemis downduetoHighlevels intheOwsandMsRonthepumpsinManualto clearthealarmspumpedtheProductRecoveryTankwhichfloodwhentheOwsgetsa HighHighLevel TestedthefloattreeswitchfortheOws itisnotactivatingtheowstransferpumpThefloat treewasreplacedapprox2weeksagoandthesystemranwellfor 2weeksWillreplacetheFloattree againandseeifthatistheissueoranotherissueincontrolwiring Alsothe2ndcarbonunitisnotflowingwellprobablyisgettingcloggedupBothCarbonunitsneedtobe changedout WillorderanotherFloatswithandtrytorestartafterthegettingtheswitch Daily Work Log Page____ of ____ Date:Project Number: Daily Work Log Page____ of ____ Date:Client: Project Number: Weather & Site Conditions: Equipment: Personnel Onsite: Tailgate Safety Meeting Notes: Instruments & Calibration: Work Log & Notes: Daily Objective: Time Onsite:Time Offsite: Project Name:Project Location: Field Personnel: Project Manager: I 6 14 23 Speedway Speedway7971Conover ConoverNC TimDickey B Schaefer 60690569 TroubleshootandgettheDPEsysteminoperatingcondition 0815 CloudyHumidVeryWarm NA NA ReviewHASPandSafetyProcedures NA Arrivedthereis a EasternEnvironmentalManagementvactruckalongwithAtlas setuponawellbesidetheFronttankpitWorkedongettingtheOwsfloatswitchworkingtoactivatetheowstransferPumpcheckedallofthe switcheswiringconnectionsinlineandinthecontrolpanelTightenedeverythingandtestedpumpactivated Restartedthesystemtoobserveoperation TheOwstransferpumptransferd atimes onthe3rdtimethepumpdidnotactivatewhenthepumpon Floatwasreached Couldpossiblybeanissueinthecontrolpanel systemwasleftoff Daily Work Log Page____ of ____ Date:Project Number: Site Name:Personnel: Date: Arrival Departure On / Off On / Off "Hg °F "Hg "H2O PSI "H2O PSI "Hg "Hg "Hg Gallons %% Inches Effluent Flow Totalizer: Influent Moisture Separator Vacuum: Well Leg 1 Vacuum:Well Leg 2 Vacuum: Well Leg 3 Vacuum: Effluent Moisture Separator Vacuum: Vacuum Blower Hour Meter:MS Pump Hour Meter: OWS Pump Hour Meter:Aerator Blower Hour Meter: Aerator Discharge Pressure Arrival Time: Repair above issues: MS Vapor Temperature Aerator Influent Pressure Aerator Pump Hour Meter: DP Vacuum Blower Discharge LEL:Room LEL: Product Tank Level: Remediation System Operation & Maintenance Inspect entire system for loose bolts, loose connections, broken components, rust, clogging, or leakage: Project Number: Departure Time: Dual Phase Extraction System Page 1 of 2 ConoverNC 7971 TimDickey 6120123 60690569 0750 1415 O O 13383.8 1255.3 471.9 19245.7 4985.9 16.3 212 16.5 46 1.65 6.5 0.23 11 12.5 5.5 506157.39 O O 10 Carbonvessels lis cloggedandthe2ndisveryslowgettingclogged TheowspumphasanissuewithactivatingsometimesitactivatessometimesitdoesnotHavereplacedthe Floatswitchandthathelpedforawhilebutdidnotsolvetheproblem stilltroubleshootingwhytheOwsPumpisactivatingperiodicallyandnotallofthetimeMayneedtogetan electricianinvolvedtofindtheissue Date:Site Name: Log/Notes: Page 2 of 2 phg g ConoverNC797 Arrived completedsafetyReview CollectedtheQuart.lyWaterDischargeSample ConoverEffluent 1020hadrunowspumponmanualtomorewater throughthesystem CollectedanAirStackEffluentsample ConoverAirstackEFF 1045 TooksampleforanalysistoPaceAnalyticalHuntersvilleNC Site Name:Personnel: Date: Arrival Departure On / Off On / Off "Hg °F "Hg "H2O PSI "H2O PSI "Hg "Hg "Hg Gallons %% Inches Log/Notes: Room LEL: Product Tank Level: Remediation System Operation & Maintenance Project Number: Departure Time: Dual Phase Extraction System Arrival Time: MS Vapor Temperature Aerator Influent Pressure Effluent Moisture Separator Vacuum: Vacuum Blower Hour Meter:MS Pump Hour Meter: OWS Pump Hour Meter:Aerator Blower Hour Meter: Aerator Discharge Pressure Effluent Flow Totalizer: pH: Influent Moisture Separator Vacuum: Well Leg 1 Vacuum:Well Leg 2 Vacuum: Well Leg 3 Vacuum: Aerator Pump Hour Meter: DP Vacuum Blower Discharge LEL: Page 1 of 2 SWConoverNC TimDickey 7 2423 60690569 0800 1435 O O O O Systemdoesnotrun consistentlydueacontrolwiringcomponent FortheOwsfloat switchsignaltoturnontheOwstransferPump sometimesthesignalispickedupandsometimesitisnot Beganmovingthewaterthruthesystemmanually Couldnotkeepthesystemoperatingdueto HighHighLevel alarms to beable totakethereadingsandget a monthlyairvapordischargesample Thecarbonunits arebothclogged I is completelycloggedandtheotheris notlettingverymuchflow thruandcausing a AeratorTank HighHighLevel Date:Site Name: Inspect entire system for loose bolts, loose connections, broken components, rust, clogging, or leakage: Repair above issues: Page 2 of 2 7124123 Appendix B Laboratory Analytical Reports #=CL# December 28, 2022 LIMS USE: FR - BRETT SCHAEFER LIMS OBJECT ID: 92642655 92642655 Project: Pace Project No.: RE: Brett Schaefer AECOM 6000 Fairview Road Suite 200 Charlotte, NC 28210 7971 CONOVER Dear Brett Schaefer: Enclosed are the analytical results for sample(s) received by the laboratory on December 16, 2022. The results relate only to the samples included in this report. Results reported herein conform to the applicable TNI/NELAC Standards and the laboratory's Quality Manual, where applicable, unless otherwise noted in the body of the report. The test results provided in this final report were generated by each of the following laboratories within the Pace Network: • Pace National - Mt. Juliet If you have any questions concerning this report, please feel free to contact me. Sincerely, Bonnie Vang bonnie.vang@pacelabs.com Project Manager (704)875-9092 Enclosures REPORT OF LABORATORY ANALYSIS This report shall not be reproduced, except in full, without the written consent of Pace Analytical Services, LLC. Pace Analytical Services, LLC 9800 Kincey Ave. Suite 100 Huntersville, NC 28078 (704)875-9092 Page 1 of 11 #=CP# CERTIFICATIONS Pace Project No.: Project: 92642655 7971 CONOVER Pace Analytical Services National 12065 Lebanon Road, Mt. Juliet, TN 37122 Alabama Certification #: 40660 Alaska Certification 17-026 Arizona Certification #: AZ0612 Arkansas Certification #: 88-0469 California Certification #: 2932 Canada Certification #: 1461.01 Colorado Certification #: TN00003 Connecticut Certification #: PH-0197 DOD Certification: #1461.01 EPA# TN00003 Florida Certification #: E87487 Georgia DW Certification #: 923 Georgia Certification: NELAP Idaho Certification #: TN00003 Illinois Certification #: 200008 Indiana Certification #: C-TN-01 Iowa Certification #: 364 Kansas Certification #: E-10277 Kentucky UST Certification #: 16 Kentucky Certification #: 90010 Louisiana Certification #: AI30792 Louisiana DW Certification #: LA180010 Maine Certification #: TN0002 Maryland Certification #: 324 Massachusetts Certification #: M-TN003 Michigan Certification #: 9958 Minnesota Certification #: 047-999-395 Mississippi Certification #: TN00003 Missouri Certification #: 340 Montana Certification #: CERT0086 Nebraska Certification #: NE-OS-15-05 Nevada Certification #: TN-03-2002-34 New Hampshire Certification #: 2975 New Jersey Certification #: TN002 New Mexico DW Certification New York Certification #: 11742 North Carolina Aquatic Toxicity Certification #: 41 North Carolina Drinking Water Certification #: 21704 North Carolina Environmental Certificate #: 375 North Dakota Certification #: R-140 Ohio VAP Certification #: CL0069 Oklahoma Certification #: 9915 Oregon Certification #: TN200002 Pennsylvania Certification #: 68-02979 Rhode Island Certification #: LAO00356 South Carolina Certification #: 84004 South Dakota Certification Tennessee DW/Chem/Micro Certification #: 2006 Texas Mold Certification #: LAB0152 Texas Certification #: T 104704245-17-14 USDA Soil Permit #: P330-15-00234 Utah Certification #: TN00003 Virginia Certification #: VT2006 Vermont Dept. of Health: ID# VT-2006 Virginia Certification #: 460132 Washington Certification #: C847 West Virginia Certification #: 233 Wisconsin Certification #: 998093910 Wyoming UST Certification #: via A2LA 2926.01 A2LA-ISO 17025 Certification #: 1461.01 A2LA-ISO 17025 Certification #: 1461.02 AIHA-LAP/LLC EMLAP Certification #:100789 REPORT OF LABORATORY ANALYSIS This report shall not be reproduced, except in full, without the written consent of Pace Analytical Services, LLC. Pace Analytical Services, LLC 9800 Kincey Ave. Suite 100 Huntersville, NC 28078 (704)875-9092 Page 2 of 11 #=SS# SAMPLE SUMMARY Pace Project No.: Project: 92642655 7971 CONOVER Lab ID Sample ID Matrix Date Collected Date Received 92642655001 AIR STACK Air 12/15/22 11:00 12/16/22 10:28 REPORT OF LABORATORY ANALYSIS This report shall not be reproduced, except in full, without the written consent of Pace Analytical Services, LLC. Pace Analytical Services, LLC 9800 Kincey Ave. Suite 100 Huntersville, NC 28078 (704)875-9092 Page 3 of 11 #=SA# SAMPLE ANALYTE COUNT Pace Project No.: Project: 92642655 7971 CONOVER Lab ID Sample ID Method Analytes Reported LaboratoryAnalysts 92642655001 AIR STACK Method 18 Air MeOH & EtOH 8 PANDAH, SDS PAN = Pace National - Mt. Juliet REPORT OF LABORATORY ANALYSIS This report shall not be reproduced, except in full, without the written consent of Pace Analytical Services, LLC. Pace Analytical Services, LLC 9800 Kincey Ave. Suite 100 Huntersville, NC 28078 (704)875-9092 Page 4 of 11 #=HO# SUMMARY OF DETECTION Pace Project No.: Project: 92642655 7971 CONOVER Parameters AnalyzedResult Lab Sample ID Report Limit QualifiersUnitsMethod Client Sample ID 92642655001 AIR STACK Benzene 3930 ug/m3 12/28/22 00:3063.9Method 18 Air MeOH & EtOH Toluene 23900 ug/m3 12/28/22 00:30188Method 18 Air MeOH & EtOH Ethylbenzene 3460 ug/m3 12/28/22 00:3086.7Method 18 Air MeOH & EtOH m&p-Xylene 12300 ug/m3 12/28/22 00:30173Method 18 Air MeOH & EtOH o-Xylene 5330 ug/m3 12/28/22 00:3086.7Method 18 Air MeOH & EtOH Gasoline Range Organics 283000 ug/m3 12/28/22 00:3082600Method 18 Air MeOH & EtOH REPORT OF LABORATORY ANALYSIS This report shall not be reproduced, except in full, without the written consent of Pace Analytical Services, LLC. Pace Analytical Services, LLC 9800 Kincey Ave. Suite 100 Huntersville, NC 28078 (704)875-9092 Page 5 of 11 #=AR# ANALYTICAL RESULTS Pace Project No.: Project: 92642655 7971 CONOVER Sample:AIR STACK Lab ID:92642655001 Collected:12/15/22 11:00 Received:12/16/22 10:28 Matrix:Air Parameters Results Units DF Prepared Analyzed CAS No.QualMDLLimit Report Analytical Method: Method 18 Air MeOH & EtOH Preparation Method: M18-Mod Pace National - Mt. Juliet VOA (MS) M18-Mod Benzene 3930 ug/m3 12/28/22 00:30 71-43-212/28/22 00:3063.9 22.8 100 Toluene 23900 ug/m3 12/28/22 00:30 108-88-312/28/22 00:3018832.8 100 Ethylbenzene 3460 ug/m3 12/28/22 00:30 100-41-412/28/22 00:3086.7 36.2 100 m&p-Xylene 12300 ug/m3 12/28/22 00:30 179601-23-112/28/22 00:3017358.5 100 o-Xylene 5330 ug/m3 12/28/22 00:30 95-47-612/28/22 00:3086.7 35.9 100 Methyl-tert-butyl ether ND ug/m3 12/24/22 19:04 1634-04-412/24/22 19:041.25 0.407 1.74 Gasoline Range Organics 283000 ug/m3 12/28/22 00:30 8006-61-912/28/22 00:308260016400100 Surrogates 1,4-Dichlorobenzene-d4 (IS)176 %12/24/22 19:04 3855-82-1 ST12/24/22 19:0460.0-140 1.74 1,4-Dichlorobenzene-d4 (IS)100 %12/28/22 00:30 3855-82-112/28/22 00:3060.0-140 100 REPORT OF LABORATORY ANALYSIS This report shall not be reproduced, except in full, without the written consent of Pace Analytical Services, LLC.Date: 12/28/2022 11:41 AM Pace Analytical Services, LLC 9800 Kincey Ave. Suite 100 Huntersville, NC 28078 (704)875-9092 Page 6 of 11 #=QC# QUALITY CONTROL DATA Pace Project No.: Project: 92642655 7971 CONOVER Results presented on this page are in the units indicated by the "Units" column except where an alternate unit is presented to the right of the result. QC Batch: QC Batch Method: Analysis Method: Analysis Description: 1979283 TO-15 Method 18 Air MeOH & EtOH VOA (MS) M18-Mod Laboratory:Pace National - Mt. Juliet Associated Lab Samples:92642655001 Parameter Units Blank Result Reporting Limit Qualifiers METHOD BLANK:R3875511-3 Associated Lab Samples:92642655001 Matrix:Air AnalyzedMDL Methyl-tert-butyl ether ug/m3 ND 0.721 12/24/22 11:360.233 1,4-Dichlorobenzene-d4 (IS)%92.5 60.0-140 12/24/22 11:36 Parameter Units LCS Result % Rec Limits Qualifiers% RecConc. R3875511-1LABORATORY CONTROL SAMPLE & LCSD: LCSSpike LCSD % Rec RPD Max RPD LCSD Result R3875511-2 Methyl-tert-butyl ether ug/m3 15.713.5 117 70.0-13011515.6 1.15 25 1,4-Dichlorobenzene-d4 (IS)%97.5 60.0-14098.2 REPORT OF LABORATORY ANALYSIS This report shall not be reproduced, except in full, without the written consent of Pace Analytical Services, LLC.Date: 12/28/2022 11:41 AM Pace Analytical Services, LLC 9800 Kincey Ave. Suite 100 Huntersville, NC 28078 (704)875-9092 Page 7 of 11 #=QC# QUALITY CONTROL DATA Pace Project No.: Project: 92642655 7971 CONOVER Results presented on this page are in the units indicated by the "Units" column except where an alternate unit is presented to the right of the result. QC Batch: QC Batch Method: Analysis Method: Analysis Description: 1979799 TO-15 Method 18 Air MeOH & EtOH VOA (MS) M18-Mod Laboratory:Pace National - Mt. Juliet Associated Lab Samples:92642655001 Parameter Units Blank Result Reporting Limit Qualifiers METHOD BLANK:R3875739-3 Associated Lab Samples:92642655001 Matrix:Air AnalyzedMDL Benzene ug/m3 ND 0.639 12/27/22 12:130.228 Toluene ug/m3 ND 1.88 12/27/22 12:130.328 Ethylbenzene ug/m3 ND 0.867 12/27/22 12:130.362 m&p-Xylene ug/m3 ND 1.73 12/27/22 12:130.585 o-Xylene ug/m3 ND 0.867 12/27/22 12:130.359 Gasoline Range Organics ug/m3 ND 826 12/27/22 12:13164 1,4-Dichlorobenzene-d4 (IS)%95.5 60.0-140 12/27/22 12:13 Parameter Units LCS Result % Rec Limits Qualifiers% RecConc. R3875739-1LABORATORY CONTROL SAMPLE & LCSD: LCSSpike LCSD % Rec RPD Max RPD LCSD Result R3875739-2 Benzene ug/m3 12.412.0 104 70.0-13010412.4 0.00 25 Toluene ug/m3 15.114.1 107 70.0-13010715.2 0.498 25 Ethylbenzene ug/m3 18.016.3 111 70.0-13011218.2 0.719 25 m&p-Xylene ug/m3 36.432.5 112 70.0-13011236.4 0.119 25 o-Xylene ug/m3 17.916.3 110 70.0-13011118.0 0.482 25 Gasoline Range Organics ug/m3 855839 102 70.0-130102855 0.00 25 1,4-Dichlorobenzene-d4 (IS)%97.4 60.0-14097.1 REPORT OF LABORATORY ANALYSIS This report shall not be reproduced, except in full, without the written consent of Pace Analytical Services, LLC.Date: 12/28/2022 11:41 AM Pace Analytical Services, LLC 9800 Kincey Ave. Suite 100 Huntersville, NC 28078 (704)875-9092 Page 8 of 11 #=QL# QUALIFIERS Pace Project No.: Project: 92642655 7971 CONOVER DEFINITIONS DF - Dilution Factor, if reported, represents the factor applied to the reported data due to dilution of the sample aliquot. ND - Not Detected at or above adjusted reporting limit. TNTC - Too Numerous To Count J - Estimated concentration above the adjusted method detection limit and below the adjusted reporting limit. MDL - Adjusted Method Detection Limit. PQL - Practical Quantitation Limit. RL - Reporting Limit - The lowest concentration value that meets project requirements for quantitative data with known precision and bias for a specific analyte in a specific matrix. S - Surrogate 1,2-Diphenylhydrazine decomposes to and cannot be separated from Azobenzene using Method 8270. The result for each analyte is a combined concentration. Consistent with EPA guidelines, unrounded data are displayed and have been used to calculate % recovery and RPD values. LCS(D) - Laboratory Control Sample (Duplicate) MS(D) - Matrix Spike (Duplicate) DUP - Sample Duplicate RPD - Relative Percent Difference NC - Not Calculable. SG - Silica Gel - Clean-Up U - Indicates the compound was analyzed for, but not detected. Acid preservation may not be appropriate for 2 Chloroethylvinyl ether. A separate vial preserved to a pH of 4-5 is recommended in SW846 Chapter 4 for the analysis of Acrolein and Acrylonitrile by EPA Method 8260. N-Nitrosodiphenylamine decomposes and cannot be separated from Diphenylamine using Method 8270. The result reported for each analyte is a combined concentration. Reported results are not rounded until the final step prior to reporting. Therefore, calculated parameters that are typically reported as "Total" may vary slightly from the sum of the reported component parameters. Pace Analytical is TNI accredited. Contact your Pace PM for the current list of accredited analytes. TNI - The NELAC Institute. SAMPLE QUALIFIERS Sample: 92642655001 Volatile Organic Compounds (MS) by Method M18-Mod - Surrogate failure due to matrix interference.[1] ANALYTE QUALIFIERS Surrogate recovery was above laboratory control limits. Results may be biased high.ST REPORT OF LABORATORY ANALYSIS This report shall not be reproduced, except in full, without the written consent of Pace Analytical Services, LLC.Date: 12/28/2022 11:41 AM Pace Analytical Services, LLC 9800 Kincey Ave. Suite 100 Huntersville, NC 28078 (704)875-9092 Page 9 of 11 #=CR# QUALITY CONTROL DATA CROSS REFERENCE TABLE Pace Project No.: Project: 92642655 7971 CONOVER Lab ID Sample ID QC Batch Method QC Batch Analytical Method Analytical Batch 92642655001 1979283 1979283AIR STACK M18-Mod Method 18 Air MeOH &EtOH 92642655001 1979799 1979799AIR STACK M18-Mod Method 18 Air MeOH & EtOH REPORT OF LABORATORY ANALYSIS This report shall not be reproduced, except in full, without the written consent of Pace Analytical Services, LLC.Date: 12/28/2022 11:41 AM Pace Analytical Services, LLC 9800 Kincey Ave. Suite 100 Huntersville, NC 28078 (704)875-9092 Page 10 of 11 Page 11 of 11 #=CL# January 04, 2023 LIMS USE: FR - BRETT SCHAEFER LIMS OBJECT ID: 92642677 92642677 Project: Pace Project No.: RE: Brett Schaefer AECOM 6000 Fairview Road Suite 200 Charlotte, NC 28210 7971 CONOVER Dear Brett Schaefer: Enclosed are the analytical results for sample(s) received by the laboratory on December 16, 2022. The results relate only to the samples included in this report. Results reported herein conform to the applicable TNI/NELAC Standards and the laboratory's Quality Manual, where applicable, unless otherwise noted in the body of the report. The test results provided in this final report were generated by each of the following laboratories within the Pace Network: • Pace Analytical Services - Asheville • Pace Analytical Services - Charlotte • Pace Analytical Services - Peachtree Corners, GA If you have any questions concerning this report, please feel free to contact me. Sincerely, Bonnie Vang bonnie.vang@pacelabs.com Project Manager (704)875-9092 Enclosures REPORT OF LABORATORY ANALYSIS This report shall not be reproduced, except in full, without the written consent of Pace Analytical Services, LLC. Pace Analytical Services, LLC 9800 Kincey Ave. Suite 100 Huntersville, NC 28078 (704)875-9092 Page 1 of 16 #=CP# CERTIFICATIONS Pace Project No.: Project: 92642677 7971 CONOVER Pace Analytical Services Charlotte South Carolina Laboratory ID: 99006 9800 Kincey Ave. Ste 100, Huntersville, NC 28078 North Carolina Drinking Water Certification #: 37706 North Carolina Field Services Certification #: 5342 North Carolina Wastewater Certification #: 12 South Carolina Laboratory ID: 99006 South Carolina Certification #: 99006001 South Carolina Drinking Water Cert. #: 99006003 Florida/NELAP Certification #: E87627 Kentucky UST Certification #: 84 Louisiana DoH Drinking Water #: LA029 Virginia/VELAP Certification #: 460221 Pace Analytical Services Asheville 2225 Riverside Drive, Asheville, NC 28804 Florida/NELAP Certification #: E87648 North Carolina Drinking Water Certification #: 37712 North Carolina Wastewater Certification #: 40 South Carolina Laboratory ID: 99030 South Carolina Certification #: 99030001 Virginia/VELAP Certification #: 460222 Pace Analytical Services Peachtree Corners 110 Technology Pkwy, Peachtree Corners, GA 30092 Florida DOH Certification #: E87315 Georgia DW Inorganics Certification #: 812 North Carolina Certification #: 381 South Carolina Certification #: 98011001 REPORT OF LABORATORY ANALYSIS This report shall not be reproduced, except in full, without the written consent of Pace Analytical Services, LLC. Pace Analytical Services, LLC 9800 Kincey Ave. Suite 100 Huntersville, NC 28078 (704)875-9092 Page 2 of 16 #=SS# SAMPLE SUMMARY Pace Project No.: Project: 92642677 7971 CONOVER Lab ID Sample ID Matrix Date Collected Date Received 92642677001 EFF 121522 Water 12/15/22 10:30 12/16/22 10:30 REPORT OF LABORATORY ANALYSIS This report shall not be reproduced, except in full, without the written consent of Pace Analytical Services, LLC. Pace Analytical Services, LLC 9800 Kincey Ave. Suite 100 Huntersville, NC 28078 (704)875-9092 Page 3 of 16 #=SA# SAMPLE ANALYTE COUNT Pace Project No.: Project: 92642677 7971 CONOVER Lab ID Sample ID Method Analytes Reported LaboratoryAnalysts 92642677001 EFF 121522 EPA 1664B 1 PASI-CREL EPA 6020B 1 PASI-GACW1 EPA 8260D 5 PASI-CSAS SM 2540D-2015 1 PASI-AJMH1 EPA 420.4 Rev 1.0 1993 1 PASI-AKDF1 PASI-A = Pace Analytical Services - Asheville PASI-C = Pace Analytical Services - Charlotte PASI-GA = Pace Analytical Services - Peachtree Corners, GA REPORT OF LABORATORY ANALYSIS This report shall not be reproduced, except in full, without the written consent of Pace Analytical Services, LLC. Pace Analytical Services, LLC 9800 Kincey Ave. Suite 100 Huntersville, NC 28078 (704)875-9092 Page 4 of 16 #=HO# SUMMARY OF DETECTION Pace Project No.: Project: 92642677 7971 CONOVER Parameters AnalyzedResult Lab Sample ID Report Limit QualifiersUnitsMethod Client Sample ID 92642677001 EFF 121522 Lead 2.2 ug/L 01/03/23 16:431.0EPA 6020B Phenolics, Total Recoverable 0.054 mg/L 12/21/22 15:040.020EPA 420.4 Rev 1.0 1993 REPORT OF LABORATORY ANALYSIS This report shall not be reproduced, except in full, without the written consent of Pace Analytical Services, LLC. Pace Analytical Services, LLC 9800 Kincey Ave. Suite 100 Huntersville, NC 28078 (704)875-9092 Page 5 of 16 #=AR# ANALYTICAL RESULTS Pace Project No.: Project: 92642677 7971 CONOVER Sample:EFF 121522 Lab ID:92642677001 Collected:12/15/22 10:30 Received:12/16/22 10:30 Matrix:Water Parameters Results Units DF Prepared Analyzed CAS No.QualMDLLimit Report Analytical Method: EPA 1664B Pace Analytical Services - Charlotte HEM, Oil and Grease Oil and Grease ND mg/L 12/28/22 00:154.9 1.1 1 Analytical Method: EPA 6020B Preparation Method: EPA 3005A Pace Analytical Services - Peachtree Corners, GA 6020 MET ICPMS Lead 2.2 ug/L 01/03/23 16:43 7439-92-112/27/22 17:441.0 0.89 1 Analytical Method: EPA 8260D Pace Analytical Services - Charlotte 8260D MSV Low Level Diisopropyl ether ND ug/L 12/21/22 03:19 108-20-31.0 0.31 1 Methyl-tert-butyl ether ND ug/L 12/21/22 03:19 1634-04-41.0 0.42 1 Surrogates 4-Bromofluorobenzene (S)98 %12/21/22 03:19 460-00-470-130 1 1,2-Dichloroethane-d4 (S)101 %12/21/22 03:19 17060-07-070-130 1 Toluene-d8 (S)117 %12/21/22 03:19 2037-26-570-130 1 Analytical Method: SM 2540D-2015 Pace Analytical Services - Asheville 2540D Total Suspended Solids Total Suspended Solids ND mg/L 12/21/22 14:212.5 2.5 1 Analytical Method: EPA 420.4 Rev 1.0 1993 Preparation Method: EPA 420.4 Rev 1.0 1993 Pace Analytical Services - Asheville 420.4 Phenolics, Total Phenolics, Total Recoverable 0.054 mg/L 12/21/22 15:04 64743-03-912/21/22 10:350.020 0.0076 1 REPORT OF LABORATORY ANALYSIS This report shall not be reproduced, except in full, without the written consent of Pace Analytical Services, LLC.Date: 01/04/2023 04:24 PM Pace Analytical Services, LLC 9800 Kincey Ave. Suite 100 Huntersville, NC 28078 (704)875-9092 Page 6 of 16 #=QC# QUALITY CONTROL DATA Pace Project No.: Project: 92642677 7971 CONOVER Results presented on this page are in the units indicated by the "Units" column except where an alternate unit is presented to the right of the result. QC Batch: QC Batch Method: Analysis Method: Analysis Description: 746031 EPA 1664B EPA 1664B 1664 HEM, Oil and Grease Laboratory:Pace Analytical Services - Charlotte Associated Lab Samples:92642677001 Parameter Units Blank Result Reporting Limit Qualifiers METHOD BLANK:3880340 Associated Lab Samples:92642677001 Matrix:Water AnalyzedMDL Oil and Grease mg/L ND 5.0 12/28/22 00:151.1 Parameter Units LCS Result % Rec Limits Qualifiers% RecConc. 3880341LABORATORY CONTROL SAMPLE: LCSSpike Oil and Grease mg/L 34.640 86 78-114 Parameter Units MS Result % Rec Limits Qualifiers% RecConc. 3880342MATRIX SPIKE SAMPLE: MSSpike Result 92641743001 Oil and Grease mg/L 38.138.5 96 78-114ND Parameter Units Dup Result Max RPD QualifiersRPDResult 92642640002 3880343SAMPLE DUPLICATE: Oil and Grease mg/L 2.1J 30ND REPORT OF LABORATORY ANALYSIS This report shall not be reproduced, except in full, without the written consent of Pace Analytical Services, LLC.Date: 01/04/2023 04:24 PM Pace Analytical Services, LLC 9800 Kincey Ave. Suite 100 Huntersville, NC 28078 (704)875-9092 Page 7 of 16 #=QC# QUALITY CONTROL DATA Pace Project No.: Project: 92642677 7971 CONOVER Results presented on this page are in the units indicated by the "Units" column except where an alternate unit is presented to the right of the result. QC Batch: QC Batch Method: Analysis Method: Analysis Description: 746005 EPA 3005A EPA 6020B 6020 MET Laboratory:Pace Analytical Services - Peachtree Corners, GA Associated Lab Samples:92642677001 Parameter Units Blank Result Reporting Limit Qualifiers METHOD BLANK:3880266 Associated Lab Samples:92642677001 Matrix:Water AnalyzedMDL Lead ug/L ND 1.0 01/03/23 14:310.89 Parameter Units LCS Result % Rec Limits Qualifiers% RecConc. 3880267LABORATORY CONTROL SAMPLE: LCSSpike Lead ug/L 102100 102 80-120 Parameter Units MS Result % Rec Limits Qual% RecConc. 3880268MATRIX SPIKE & MATRIX SPIKE DUPLICATE: MSSpike Result 92641696001 3880269 MSD Result MSD % Rec RPD RPD Max MSDMS Spike Conc. Lead ug/L 100 94 75-12594 1 20100ND93.9 94.5 REPORT OF LABORATORY ANALYSIS This report shall not be reproduced, except in full, without the written consent of Pace Analytical Services, LLC.Date: 01/04/2023 04:24 PM Pace Analytical Services, LLC 9800 Kincey Ave. Suite 100 Huntersville, NC 28078 (704)875-9092 Page 8 of 16 #=QC# QUALITY CONTROL DATA Pace Project No.: Project: 92642677 7971 CONOVER Results presented on this page are in the units indicated by the "Units" column except where an alternate unit is presented to the right of the result. QC Batch: QC Batch Method: Analysis Method: Analysis Description: 744441 EPA 8260D EPA 8260D 8260D MSV Low Level Laboratory:Pace Analytical Services - Charlotte Associated Lab Samples:92642677001 Parameter Units Blank Result Reporting Limit Qualifiers METHOD BLANK:3873013 Associated Lab Samples:92642677001 Matrix:Water AnalyzedMDL Diisopropyl ether ug/L ND 1.0 12/20/22 22:480.31 Methyl-tert-butyl ether ug/L ND 1.0 12/20/22 22:480.42 1,2-Dichloroethane-d4 (S)%97 70-130 12/20/22 22:48 4-Bromofluorobenzene (S)%100 70-130 12/20/22 22:48 Toluene-d8 (S)%113 70-130 12/20/22 22:48 Parameter Units LCS Result % Rec Limits Qualifiers% RecConc. 3873014LABORATORY CONTROL SAMPLE: LCSSpike Diisopropyl ether ug/L 51.150 102 70-130 Methyl-tert-butyl ether ug/L 51.450 103 70-130 1,2-Dichloroethane-d4 (S)%99 70-130 4-Bromofluorobenzene (S)%97 70-130 Toluene-d8 (S)%97 70-130 Parameter Units MS Result % Rec Limits Qual% RecConc. 3873015MATRIX SPIKE & MATRIX SPIKE DUPLICATE: MSSpike Result 92642837007 3873016 MSD Result MSD % Rec RPD RPD Max MSDMS Spike Conc. Diisopropyl ether ug/L 80 104 67-142108 4 3080ND83.0 86.8 Methyl-tert-butyl ether ug/L 80 98 65-14398 0 3080ND78.1 78.1 1,2-Dichloroethane-d4 (S)%94 70-13094 4-Bromofluorobenzene (S)%97 70-13097 Toluene-d8 (S)%98 70-130100 REPORT OF LABORATORY ANALYSIS This report shall not be reproduced, except in full, without the written consent of Pace Analytical Services, LLC.Date: 01/04/2023 04:24 PM Pace Analytical Services, LLC 9800 Kincey Ave. Suite 100 Huntersville, NC 28078 (704)875-9092 Page 9 of 16 #=QC# QUALITY CONTROL DATA Pace Project No.: Project: 92642677 7971 CONOVER Results presented on this page are in the units indicated by the "Units" column except where an alternate unit is presented to the right of the result. QC Batch: QC Batch Method: Analysis Method: Analysis Description: 744971 SM 2540D-2015 SM 2540D-2015 2540D Total Suspended Solids Laboratory:Pace Analytical Services - Asheville Associated Lab Samples:92642677001 Parameter Units Blank Result Reporting Limit Qualifiers METHOD BLANK:3875620 Associated Lab Samples:92642677001 Matrix:Water AnalyzedMDL Total Suspended Solids mg/L ND 2.5 12/21/22 14:202.5 Parameter Units LCS Result % Rec Limits Qualifiers% RecConc. 3875621LABORATORY CONTROL SAMPLE: LCSSpike Total Suspended Solids mg/L 248250 99 90-110 Parameter Units Dup Result Max RPD QualifiersRPDResult 92642857005 3875876SAMPLE DUPLICATE: Total Suspended Solids mg/L 229 3 25235 Parameter Units Dup Result Max RPD QualifiersRPDResult 92642857006 3875877SAMPLE DUPLICATE: Total Suspended Solids mg/L 1460 2 251430 REPORT OF LABORATORY ANALYSIS This report shall not be reproduced, except in full, without the written consent of Pace Analytical Services, LLC.Date: 01/04/2023 04:24 PM Pace Analytical Services, LLC 9800 Kincey Ave. Suite 100 Huntersville, NC 28078 (704)875-9092 Page 10 of 16 #=QC# QUALITY CONTROL DATA Pace Project No.: Project: 92642677 7971 CONOVER Results presented on this page are in the units indicated by the "Units" column except where an alternate unit is presented to the right of the result. QC Batch: QC Batch Method: Analysis Method: Analysis Description: 744609 EPA 420.4 Rev 1.0 1993 EPA 420.4 Rev 1.0 1993 420.4 Phenolics Laboratory:Pace Analytical Services - Asheville Associated Lab Samples:92642677001 Parameter Units Blank Result Reporting Limit Qualifiers METHOD BLANK:3873499 Associated Lab Samples:92642677001 Matrix:Water AnalyzedMDL Phenolics, Total Recoverable mg/L ND 0.020 12/21/22 13:420.0076 Parameter Units LCS Result % Rec Limits Qualifiers% RecConc. 3873500LABORATORY CONTROL SAMPLE: LCSSpike Phenolics, Total Recoverable mg/L 0.0530.05 107 90-110 Parameter Units MS Result % Rec Limits Qual% RecConc. 3873501MATRIX SPIKE & MATRIX SPIKE DUPLICATE: MSSpike Result 92641627001 3873502 MSD Result MSD % Rec RPD RPD Max MSDMS Spike Conc. Phenolics, Total Recoverable mg/L M1,R10.05 72 90-110106 36 100.05ND 0.040 0.057 Parameter Units MS Result % Rec Limits Qual% RecConc. 3873503MATRIX SPIKE & MATRIX SPIKE DUPLICATE: MSSpike Result 92641627002 3873504 MSD Result MSD % Rec RPD RPD Max MSDMS Spike Conc. Phenolics, Total Recoverable mg/L M1,R10.05 163 90-11089 55 100.05ND 0.085 0.048 REPORT OF LABORATORY ANALYSIS This report shall not be reproduced, except in full, without the written consent of Pace Analytical Services, LLC.Date: 01/04/2023 04:24 PM Pace Analytical Services, LLC 9800 Kincey Ave. Suite 100 Huntersville, NC 28078 (704)875-9092 Page 11 of 16 #=QL# QUALIFIERS Pace Project No.: Project: 92642677 7971 CONOVER DEFINITIONS DF - Dilution Factor, if reported, represents the factor applied to the reported data due to dilution of the sample aliquot. ND - Not Detected at or above adjusted reporting limit. TNTC - Too Numerous To Count J - Estimated concentration above the adjusted method detection limit and below the adjusted reporting limit. MDL - Adjusted Method Detection Limit. PQL - Practical Quantitation Limit. RL - Reporting Limit - The lowest concentration value that meets project requirements for quantitative data with known precision and bias for a specific analyte in a specific matrix. S - Surrogate 1,2-Diphenylhydrazine decomposes to and cannot be separated from Azobenzene using Method 8270. The result for each analyte is a combined concentration. Consistent with EPA guidelines, unrounded data are displayed and have been used to calculate % recovery and RPD values. LCS(D) - Laboratory Control Sample (Duplicate) MS(D) - Matrix Spike (Duplicate) DUP - Sample Duplicate RPD - Relative Percent Difference NC - Not Calculable. SG - Silica Gel - Clean-Up U - Indicates the compound was analyzed for, but not detected. Acid preservation may not be appropriate for 2 Chloroethylvinyl ether. A separate vial preserved to a pH of 4-5 is recommended in SW846 Chapter 4 for the analysis of Acrolein and Acrylonitrile by EPA Method 8260. N-Nitrosodiphenylamine decomposes and cannot be separated from Diphenylamine using Method 8270. The result reported for each analyte is a combined concentration. Reported results are not rounded until the final step prior to reporting. Therefore, calculated parameters that are typically reported as "Total" may vary slightly from the sum of the reported component parameters. Pace Analytical is TNI accredited. Contact your Pace PM for the current list of accredited analytes. TNI - The NELAC Institute. ANALYTE QUALIFIERS Matrix spike recovery exceeded QC limits. Batch accepted based on laboratory control sample (LCS) recovery.M1 RPD value was outside control limits.R1 REPORT OF LABORATORY ANALYSIS This report shall not be reproduced, except in full, without the written consent of Pace Analytical Services, LLC.Date: 01/04/2023 04:24 PM Pace Analytical Services, LLC 9800 Kincey Ave. Suite 100 Huntersville, NC 28078 (704)875-9092 Page 12 of 16 #=CR# QUALITY CONTROL DATA CROSS REFERENCE TABLE Pace Project No.: Project: 92642677 7971 CONOVER Lab ID Sample ID QC Batch Method QC Batch Analytical Method Analytical Batch 92642677001 746031EFF 121522 EPA 1664B 92642677001 746005 746121EFF 121522 EPA 3005A EPA 6020B 92642677001 744441EFF 121522 EPA 8260D 92642677001 744971EFF 121522 SM 2540D-2015 92642677001 744609 744932EFF 121522 EPA 420.4 Rev 1.0 1993 EPA 420.4 Rev 1.0 1993 REPORT OF LABORATORY ANALYSIS This report shall not be reproduced, except in full, without the written consent of Pace Analytical Services, LLC.Date: 01/04/2023 04:24 PM Pace Analytical Services, LLC 9800 Kincey Ave. Suite 100 Huntersville, NC 28078 (704)875-9092 Page 13 of 16 Page 14 of 16 Page 15 of 16 Page 16 of 16 #=CL# February 06, 2023 LIMS USE: FR - BRETT SCHAEFER LIMS OBJECT ID: 92649783 92649783 Project: Pace Project No.: RE: Brett Schaefer AECOM 6000 Fairview Road Suite 200 Charlotte, NC 28210 7971 CONOVER Dear Brett Schaefer: Enclosed are the analytical results for sample(s) received by the laboratory on February 01, 2023. The results relate only to the samples included in this report. Results reported herein conform to the applicable TNI/NELAC Standards and the laboratory's Quality Manual, where applicable, unless otherwise noted in the body of the report. The test results provided in this final report were generated by each of the following laboratories within the Pace Network: • Pace National - Mt. Juliet If you have any questions concerning this report, please feel free to contact me. Sincerely, Bonnie Vang bonnie.vang@pacelabs.com Project Manager (704)875-9092 Enclosures REPORT OF LABORATORY ANALYSIS This report shall not be reproduced, except in full, without the written consent of Pace Analytical Services, LLC. Pace Analytical Services, LLC 9800 Kincey Ave. Suite 100 Huntersville, NC 28078 (704)875-9092 Page 1 of 12 #=CP# CERTIFICATIONS Pace Project No.: Project: 92649783 7971 CONOVER Pace Analytical Services National 12065 Lebanon Road, Mt. Juliet, TN 37122 Alabama Certification #: 40660 Alaska Certification 17-026 Arizona Certification #: AZ0612 Arkansas Certification #: 88-0469 California Certification #: 2932 Canada Certification #: 1461.01 Colorado Certification #: TN00003 Connecticut Certification #: PH-0197 DOD Certification: #1461.01 EPA# TN00003 Florida Certification #: E87487 Georgia DW Certification #: 923 Georgia Certification: NELAP Idaho Certification #: TN00003 Illinois Certification #: 200008 Indiana Certification #: C-TN-01 Iowa Certification #: 364 Kansas Certification #: E-10277 Kentucky UST Certification #: 16 Kentucky Certification #: 90010 Louisiana Certification #: AI30792 Louisiana DW Certification #: LA180010 Maine Certification #: TN0002 Maryland Certification #: 324 Massachusetts Certification #: M-TN003 Michigan Certification #: 9958 Minnesota Certification #: 047-999-395 Mississippi Certification #: TN00003 Missouri Certification #: 340 Montana Certification #: CERT0086 Nebraska Certification #: NE-OS-15-05 Nevada Certification #: TN-03-2002-34 New Hampshire Certification #: 2975 New Jersey Certification #: TN002 New Mexico DW Certification New York Certification #: 11742 North Carolina Aquatic Toxicity Certification #: 41 North Carolina Drinking Water Certification #: 21704 North Carolina Environmental Certificate #: 375 North Dakota Certification #: R-140 Ohio VAP Certification #: CL0069 Oklahoma Certification #: 9915 Oregon Certification #: TN200002 Pennsylvania Certification #: 68-02979 Rhode Island Certification #: LAO00356 South Carolina Certification #: 84004 South Dakota Certification Tennessee DW/Chem/Micro Certification #: 2006 Texas Certification #: T 104704245-17-14 Texas Mold Certification #: LAB0152 USDA Soil Permit #: P330-15-00234 Utah Certification #: TN00003 Virginia Certification #: VT2006 Vermont Dept. of Health: ID# VT-2006 Virginia Certification #: 460132 Washington Certification #: C847 West Virginia Certification #: 233 Wisconsin Certification #: 998093910 Wyoming UST Certification #: via A2LA 2926.01 A2LA-ISO 17025 Certification #: 1461.01 A2LA-ISO 17025 Certification #: 1461.02 AIHA-LAP/LLC EMLAP Certification #:100789 REPORT OF LABORATORY ANALYSIS This report shall not be reproduced, except in full, without the written consent of Pace Analytical Services, LLC. Pace Analytical Services, LLC 9800 Kincey Ave. Suite 100 Huntersville, NC 28078 (704)875-9092 Page 2 of 12 #=SS# SAMPLE SUMMARY Pace Project No.: Project: 92649783 7971 CONOVER Lab ID Sample ID Matrix Date Collected Date Received 92649783001 SW CONOVER AIR STACK Air 01/31/23 19:30 02/01/23 13:33 REPORT OF LABORATORY ANALYSIS This report shall not be reproduced, except in full, without the written consent of Pace Analytical Services, LLC. Pace Analytical Services, LLC 9800 Kincey Ave. Suite 100 Huntersville, NC 28078 (704)875-9092 Page 3 of 12 #=SA# SAMPLE ANALYTE COUNT Pace Project No.: Project: 92649783 7971 CONOVER Lab ID Sample ID Method Analytes Reported LaboratoryAnalysts 92649783001 SW CONOVER AIR STACK Method 18 Air MeOH & EtOH 6 PANDBB PAN = Pace National - Mt. Juliet REPORT OF LABORATORY ANALYSIS This report shall not be reproduced, except in full, without the written consent of Pace Analytical Services, LLC. Pace Analytical Services, LLC 9800 Kincey Ave. Suite 100 Huntersville, NC 28078 (704)875-9092 Page 4 of 12 #=HO# SUMMARY OF DETECTION Pace Project No.: Project: 92649783 7971 CONOVER Parameters AnalyzedResult Lab Sample ID Report Limit QualifiersUnitsMethod Client Sample ID 92649783001 SW CONOVER AIR STACK Benzene 3420 ug/m3 02/04/23 16:2963.9Method 18 Air MeOH & EtOH Toluene 15300 ug/m3 02/04/23 16:29188Method 18 Air MeOH & EtOH Ethylbenzene 2640 ug/m3 02/04/23 16:2986.7Method 18 Air MeOH & EtOH m&p-Xylene 10000 ug/m3 02/04/23 16:29173Method 18 Air MeOH & EtOH o-Xylene 5030 ug/m3 02/04/23 16:2986.7Method 18 Air MeOH & EtOH REPORT OF LABORATORY ANALYSIS This report shall not be reproduced, except in full, without the written consent of Pace Analytical Services, LLC. Pace Analytical Services, LLC 9800 Kincey Ave. Suite 100 Huntersville, NC 28078 (704)875-9092 Page 5 of 12 #=AR# ANALYTICAL RESULTS Pace Project No.: Project: 92649783 7971 CONOVER Sample:SW CONOVER AIR STACK Lab ID:92649783001 Collected:01/31/23 19:30 Received:02/01/23 13:33 Matrix:Air Parameters Results Units DF Prepared Analyzed CAS No.QualMDLLimit Report Analytical Method: Method 18 Air MeOH & EtOH Preparation Method: M18-Mod Pace National - Mt. Juliet VOA (MS) M18-Mod Benzene 3420 ug/m3 02/04/23 16:29 71-43-202/04/23 16:2963.9 22.8 100 Toluene 15300 ug/m3 02/04/23 16:29 108-88-302/04/23 16:2918832.8 100 Ethylbenzene 2640 ug/m3 02/04/23 16:29 100-41-402/04/23 16:2986.7 36.2 100 m&p-Xylene 10000 ug/m3 02/04/23 16:29 179601-23-102/04/23 16:2917358.5 100 o-Xylene 5030 ug/m3 02/04/23 16:29 95-47-602/04/23 16:2986.7 35.9 100 Surrogates 1,4-Dichlorobenzene-d4 (IS)101 %02/04/23 16:29 3855-82-102/04/23 16:2960.0-140 100 REPORT OF LABORATORY ANALYSIS This report shall not be reproduced, except in full, without the written consent of Pace Analytical Services, LLC.Date: 02/06/2023 01:00 PM Pace Analytical Services, LLC 9800 Kincey Ave. Suite 100 Huntersville, NC 28078 (704)875-9092 Page 6 of 12 #=QC# QUALITY CONTROL DATA Pace Project No.: Project: 92649783 7971 CONOVER Results presented on this page are in the units indicated by the "Units" column except where an alternate unit is presented to the right of the result. QC Batch: QC Batch Method: Analysis Method: Analysis Description: 2000196 TO-15 Method 18 Air MeOH & EtOH VOA (MS) M18-Mod Laboratory:Pace National - Mt. Juliet Associated Lab Samples:92649783001 Parameter Units Blank Result Reporting Limit Qualifiers METHOD BLANK:R3887777-3 Associated Lab Samples:92649783001 Matrix:Air AnalyzedMDL Benzene ug/m3 ND 0.639 02/04/23 08:090.228 Toluene ug/m3 ND 1.88 02/04/23 08:090.328 Ethylbenzene ug/m3 ND 0.867 02/04/23 08:090.362 m&p-Xylene ug/m3 ND 1.73 02/04/23 08:090.585 o-Xylene ug/m3 ND 0.867 02/04/23 08:090.359 1,4-Dichlorobenzene-d4 (IS)%95.9 60.0-140 02/04/23 08:09 Parameter Units LCS Result % Rec Limits Qualifiers% RecConc. R3887777-1LABORATORY CONTROL SAMPLE & LCSD: LCSSpike LCSD % Rec RPD Max RPD LCSD Result R3887777-2 Benzene ug/m3 12.012.0 100 70.0-13010112.0 0.266 25 Toluene ug/m3 14.414.1 102 70.0-13010314.5 0.782 25 Ethylbenzene ug/m3 16.916.3 104 70.0-13010316.8 0.515 25 m&p-Xylene ug/m3 36.232.5 111 70.0-13011035.9 0.842 25 o-Xylene ug/m3 17.816.3 109 70.0-13010817.6 0.980 25 1,4-Dichlorobenzene-d4 (IS)%101 60.0-140103 REPORT OF LABORATORY ANALYSIS This report shall not be reproduced, except in full, without the written consent of Pace Analytical Services, LLC.Date: 02/06/2023 01:00 PM Pace Analytical Services, LLC 9800 Kincey Ave. Suite 100 Huntersville, NC 28078 (704)875-9092 Page 7 of 12 #=QL# QUALIFIERS Pace Project No.: Project: 92649783 7971 CONOVER DEFINITIONS DF - Dilution Factor, if reported, represents the factor applied to the reported data due to dilution of the sample aliquot. ND - Not Detected at or above adjusted reporting limit. TNTC - Too Numerous To Count J - Estimated concentration above the adjusted method detection limit and below the adjusted reporting limit. MDL - Adjusted Method Detection Limit. PQL - Practical Quantitation Limit. RL - Reporting Limit - The lowest concentration value that meets project requirements for quantitative data with known precision and bias for a specific analyte in a specific matrix. S - Surrogate 1,2-Diphenylhydrazine decomposes to and cannot be separated from Azobenzene using Method 8270. The result for each analyte is a combined concentration. Consistent with EPA guidelines, unrounded data are displayed and have been used to calculate % recovery and RPD values. LCS(D) - Laboratory Control Sample (Duplicate) MS(D) - Matrix Spike (Duplicate) DUP - Sample Duplicate RPD - Relative Percent Difference NC - Not Calculable. SG - Silica Gel - Clean-Up U - Indicates the compound was analyzed for, but not detected. Acid preservation may not be appropriate for 2 Chloroethylvinyl ether. A separate vial preserved to a pH of 4-5 is recommended in SW846 Chapter 4 for the analysis of Acrolein and Acrylonitrile by EPA Method 8260. N-Nitrosodiphenylamine decomposes and cannot be separated from Diphenylamine using Method 8270. The result reported for each analyte is a combined concentration. Reported results are not rounded until the final step prior to reporting. Therefore, calculated parameters that are typically reported as "Total" may vary slightly from the sum of the reported component parameters. Pace Analytical is TNI accredited. Contact your Pace PM for the current list of accredited analytes. TNI - The NELAC Institute. REPORT OF LABORATORY ANALYSIS This report shall not be reproduced, except in full, without the written consent of Pace Analytical Services, LLC.Date: 02/06/2023 01:00 PM Pace Analytical Services, LLC 9800 Kincey Ave. Suite 100 Huntersville, NC 28078 (704)875-9092 Page 8 of 12 #=CR# QUALITY CONTROL DATA CROSS REFERENCE TABLE Pace Project No.: Project: 92649783 7971 CONOVER Lab ID Sample ID QC Batch Method QC Batch Analytical Method Analytical Batch 92649783001 2000196 2000196SW CONOVER AIR STACK M18-Mod Method 18 Air MeOH &EtOH REPORT OF LABORATORY ANALYSIS This report shall not be reproduced, except in full, without the written consent of Pace Analytical Services, LLC.Date: 02/06/2023 01:00 PM Pace Analytical Services, LLC 9800 Kincey Ave. Suite 100 Huntersville, NC 28078 (704)875-9092 Page 9 of 12 Page 10 of 12 Page 11 of 12 Page 12 of 12 #=CL# March 31, 2023 LIMS USE: FR - BRETT SCHAEFER LIMS OBJECT ID: 92658964 92658964 Project: Pace Project No.: RE: Brett Schaefer AECOM 6000 Fairview Road Suite 200 Charlotte, NC 28210 7971 CONOVER Dear Brett Schaefer: Enclosed are the analytical results for sample(s) received by the laboratory on March 27, 2023. The results relate only to the samples included in this report. Results reported herein conform to the applicable TNI/NELAC Standards and the laboratory's Quality Manual, where applicable, unless otherwise noted in the body of the report. The test results provided in this final report were generated by each of the following laboratories within the Pace Network: • Pace National - Mt. Juliet If you have any questions concerning this report, please feel free to contact me. Sincerely, Bonnie Vang bonnie.vang@pacelabs.com Project Manager (704)875-9092 Enclosures REPORT OF LABORATORY ANALYSIS This report shall not be reproduced, except in full, without the written consent of Pace Analytical Services, LLC. Pace Analytical Services, LLC 9800 Kincey Ave. Suite 100 Huntersville, NC 28078 (704)875-9092 Page 1 of 12 #=CP# CERTIFICATIONS Pace Project No.: Project: 92658964 7971 CONOVER Pace Analytical Services National 12065 Lebanon Road, Mt. Juliet, TN 37122 Alabama Certification #: 40660 Alaska Certification 17-026 Arizona Certification #: AZ0612 Arkansas Certification #: 88-0469 California Certification #: 2932 Canada Certification #: 1461.01 Colorado Certification #: TN00003 Connecticut Certification #: PH-0197 DOD Certification: #1461.01 EPA# TN00003 Florida Certification #: E87487 Georgia DW Certification #: 923 Georgia Certification: NELAP Idaho Certification #: TN00003 Illinois Certification #: 200008 Indiana Certification #: C-TN-01 Iowa Certification #: 364 Kansas Certification #: E-10277 Kentucky UST Certification #: 16 Kentucky Certification #: 90010 Louisiana Certification #: AI30792 Louisiana DW Certification #: LA180010 Maine Certification #: TN0002 Maryland Certification #: 324 Massachusetts Certification #: M-TN003 Michigan Certification #: 9958 Minnesota Certification #: 047-999-395 Mississippi Certification #: TN00003 Missouri Certification #: 340 Montana Certification #: CERT0086 Nebraska Certification #: NE-OS-15-05 Nevada Certification #: TN-03-2002-34 New Hampshire Certification #: 2975 New Jersey Certification #: TN002 New Mexico DW Certification New York Certification #: 11742 North Carolina Aquatic Toxicity Certification #: 41 North Carolina Drinking Water Certification #: 21704 North Carolina Environmental Certificate #: 375 North Dakota Certification #: R-140 Ohio VAP Certification #: CL0069 Oklahoma Certification #: 9915 Oregon Certification #: TN200002 Pennsylvania Certification #: 68-02979 Rhode Island Certification #: LAO00356 South Carolina Certification #: 84004 South Dakota Certification Tennessee DW/Chem/Micro Certification #: 2006 Texas Certification #: T 104704245-17-14 Texas Mold Certification #: LAB0152 USDA Soil Permit #: P330-15-00234 Utah Certification #: TN00003 Virginia Certification #: VT2006 Vermont Dept. of Health: ID# VT-2006 Virginia Certification #: 460132 Washington Certification #: C847 West Virginia Certification #: 233 Wisconsin Certification #: 998093910 Wyoming UST Certification #: via A2LA 2926.01 A2LA-ISO 17025 Certification #: 1461.01 A2LA-ISO 17025 Certification #: 1461.02 AIHA-LAP/LLC EMLAP Certification #:100789 REPORT OF LABORATORY ANALYSIS This report shall not be reproduced, except in full, without the written consent of Pace Analytical Services, LLC. Pace Analytical Services, LLC 9800 Kincey Ave. Suite 100 Huntersville, NC 28078 (704)875-9092 Page 2 of 12 #=SS# SAMPLE SUMMARY Pace Project No.: Project: 92658964 7971 CONOVER Lab ID Sample ID Matrix Date Collected Date Received 92658964001 CONOVER AIR STACK EFF Air 03/27/23 11:45 03/27/23 12:55 REPORT OF LABORATORY ANALYSIS This report shall not be reproduced, except in full, without the written consent of Pace Analytical Services, LLC. Pace Analytical Services, LLC 9800 Kincey Ave. Suite 100 Huntersville, NC 28078 (704)875-9092 Page 3 of 12 #=SA# SAMPLE ANALYTE COUNT Pace Project No.: Project: 92658964 7971 CONOVER Lab ID Sample ID Method Analytes Reported LaboratoryAnalysts 92658964001 CONOVER AIR STACK EFF Method 18 Air MeOH & EtOH 6 PANSDS PAN = Pace National - Mt. Juliet REPORT OF LABORATORY ANALYSIS This report shall not be reproduced, except in full, without the written consent of Pace Analytical Services, LLC. Pace Analytical Services, LLC 9800 Kincey Ave. Suite 100 Huntersville, NC 28078 (704)875-9092 Page 4 of 12 #=HO# SUMMARY OF DETECTION Pace Project No.: Project: 92658964 7971 CONOVER Parameters AnalyzedResult Lab Sample ID Report Limit QualifiersUnitsMethod Client Sample ID 92658964001 CONOVER AIR STACK EFF Benzene 6010 ug/m3 03/30/23 23:1363.9Method 18 Air MeOH & EtOH Toluene 26400 ug/m3 03/30/23 23:13188Method 18 Air MeOH & EtOH Ethylbenzene 11700 ug/m3 03/30/23 23:1386.7Method 18 Air MeOH & EtOH m&p-Xylene 27200 ug/m3 03/30/23 23:13173Method 18 Air MeOH & EtOH o-Xylene 12800 ug/m3 03/30/23 23:1386.7Method 18 Air MeOH & EtOH REPORT OF LABORATORY ANALYSIS This report shall not be reproduced, except in full, without the written consent of Pace Analytical Services, LLC. Pace Analytical Services, LLC 9800 Kincey Ave. Suite 100 Huntersville, NC 28078 (704)875-9092 Page 5 of 12 #=AR# ANALYTICAL RESULTS Pace Project No.: Project: 92658964 7971 CONOVER Sample:CONOVER AIR STACK EFF Lab ID:92658964001 Collected:03/27/23 11:45 Received:03/27/23 12:55 Matrix:Air Parameters Results Units DF Prepared Analyzed CAS No.QualMDLLimit Report Analytical Method: Method 18 Air MeOH & EtOH Preparation Method: M18-Mod Pace National - Mt. Juliet VOA (MS) M18-Mod Benzene 6010 ug/m3 03/30/23 23:13 71-43-203/30/23 23:1363.9 22.8 100 Toluene 26400 ug/m3 03/30/23 23:13 108-88-303/30/23 23:1318832.8 100 Ethylbenzene 11700 ug/m3 03/30/23 23:13 100-41-403/30/23 23:1386.7 36.2 100 m&p-Xylene 27200 ug/m3 03/30/23 23:13 179601-23-103/30/23 23:1317358.5 100 o-Xylene 12800 ug/m3 03/30/23 23:13 95-47-603/30/23 23:1386.7 35.9 100 Surrogates 4-Bromofluorobenzene (S)101 %03/30/23 23:13 460-00-403/30/23 23:1360.0-140 100 REPORT OF LABORATORY ANALYSIS This report shall not be reproduced, except in full, without the written consent of Pace Analytical Services, LLC.Date: 03/31/2023 05:09 PM Pace Analytical Services, LLC 9800 Kincey Ave. Suite 100 Huntersville, NC 28078 (704)875-9092 Page 6 of 12 #=QC# QUALITY CONTROL DATA Pace Project No.: Project: 92658964 7971 CONOVER Results presented on this page are in the units indicated by the "Units" column except where an alternate unit is presented to the right of the result. QC Batch: QC Batch Method: Analysis Method: Analysis Description: 2032762 M18-Mod/TO-15 Method 18 Air MeOH & EtOH VOA (MS) M18-Mod Laboratory:Pace National - Mt. Juliet Associated Lab Samples:92658964001 Parameter Units Blank Result Reporting Limit Qualifiers METHOD BLANK:R3907455-3 Associated Lab Samples:92658964001 Matrix:Air AnalyzedMDL Benzene ug/m3 ND 0.639 03/30/23 10:090.228 Toluene ug/m3 ND 1.88 03/30/23 10:090.328 Ethylbenzene ug/m3 ND 0.867 03/30/23 10:090.362 m&p-Xylene ug/m3 ND 1.73 03/30/23 10:090.585 o-Xylene ug/m3 ND 0.867 03/30/23 10:090.359 4-Bromofluorobenzene (S)%99.4 60.0-140 03/30/23 10:09 Parameter Units LCS Result % Rec Limits Qualifiers% RecConc. R3907455-1LABORATORY CONTROL SAMPLE & LCSD: LCSSpike LCSD % Rec RPD Max RPD LCSD Result R3907455-2 Benzene ug/m3 12.612.0 105 70.0-13010913.0 3.50 25 Toluene ug/m3 14.414.1 102 70.0-13010715.2 5.61 25 Ethylbenzene ug/m3 17.316.3 106 70.0-13010817.6 1.49 25 m&p-Xylene ug/m3 34.732.5 107 70.0-13010634.4 0.753 25 o-Xylene ug/m3 17.316.3 106 70.0-13010517.0 1.26 25 4-Bromofluorobenzene (S)%101 60.0-14097.7 REPORT OF LABORATORY ANALYSIS This report shall not be reproduced, except in full, without the written consent of Pace Analytical Services, LLC.Date: 03/31/2023 05:09 PM Pace Analytical Services, LLC 9800 Kincey Ave. Suite 100 Huntersville, NC 28078 (704)875-9092 Page 7 of 12 #=QL# QUALIFIERS Pace Project No.: Project: 92658964 7971 CONOVER DEFINITIONS DF - Dilution Factor, if reported, represents the factor applied to the reported data due to dilution of the sample aliquot. ND - Not Detected at or above adjusted reporting limit. TNTC - Too Numerous To Count J - Estimated concentration above the adjusted method detection limit and below the adjusted reporting limit. MDL - Adjusted Method Detection Limit. PQL - Practical Quantitation Limit. RL - Reporting Limit - The lowest concentration value that meets project requirements for quantitative data with known precision and bias for a specific analyte in a specific matrix. S - Surrogate 1,2-Diphenylhydrazine decomposes to and cannot be separated from Azobenzene using Method 8270. The result for each analyte is a combined concentration. Consistent with EPA guidelines, unrounded data are displayed and have been used to calculate % recovery and RPD values. LCS(D) - Laboratory Control Sample (Duplicate) MS(D) - Matrix Spike (Duplicate) DUP - Sample Duplicate RPD - Relative Percent Difference NC - Not Calculable. SG - Silica Gel - Clean-Up U - Indicates the compound was analyzed for, but not detected. Acid preservation may not be appropriate for 2 Chloroethylvinyl ether. A separate vial preserved to a pH of 4-5 is recommended in SW846 Chapter 4 for the analysis of Acrolein and Acrylonitrile by EPA Method 8260. N-Nitrosodiphenylamine decomposes and cannot be separated from Diphenylamine using Method 8270. The result reported for each analyte is a combined concentration. Reported results are not rounded until the final step prior to reporting. Therefore, calculated parameters that are typically reported as "Total" may vary slightly from the sum of the reported component parameters. Pace Analytical is TNI accredited. Contact your Pace PM for the current list of accredited analytes. TNI - The NELAC Institute. REPORT OF LABORATORY ANALYSIS This report shall not be reproduced, except in full, without the written consent of Pace Analytical Services, LLC.Date: 03/31/2023 05:09 PM Pace Analytical Services, LLC 9800 Kincey Ave. Suite 100 Huntersville, NC 28078 (704)875-9092 Page 8 of 12 #=CR# QUALITY CONTROL DATA CROSS REFERENCE TABLE Pace Project No.: Project: 92658964 7971 CONOVER Lab ID Sample ID QC Batch Method QC Batch Analytical Method Analytical Batch 92658964001 2032762 2032762CONOVER AIR STACK EFF M18-Mod Method 18 Air MeOH &EtOH REPORT OF LABORATORY ANALYSIS This report shall not be reproduced, except in full, without the written consent of Pace Analytical Services, LLC.Date: 03/31/2023 05:09 PM Pace Analytical Services, LLC 9800 Kincey Ave. Suite 100 Huntersville, NC 28078 (704)875-9092 Page 9 of 12 Page 10 of 12 Page 11 of 12 Page 12 of 12 #=CL# April 05, 2023 LIMS USE: FR - BRETT SCHAEFER LIMS OBJECT ID: 92658989 92658989 Project: Pace Project No.: RE: Brett Schaefer AECOM 6000 Fairview Road Suite 200 Charlotte, NC 28210 7971 CONOVER Dear Brett Schaefer: Enclosed are the analytical results for sample(s) received by the laboratory on March 27, 2023. The results relate only to the samples included in this report. Results reported herein conform to the applicable TNI/NELAC Standards and the laboratory's Quality Manual, where applicable, unless otherwise noted in the body of the report. The test results provided in this final report were generated by each of the following laboratories within the Pace Network: • Pace Analytical Services - Asheville • Pace Analytical Services - Charlotte • Pace Analytical Services - Peachtree Corners, GA If you have any questions concerning this report, please feel free to contact me. Sincerely, Bonnie Vang bonnie.vang@pacelabs.com Project Manager (704)875-9092 Enclosures REPORT OF LABORATORY ANALYSIS This report shall not be reproduced, except in full, without the written consent of Pace Analytical Services, LLC. Pace Analytical Services, LLC 9800 Kincey Ave. Suite 100 Huntersville, NC 28078 (704)875-9092 Page 1 of 21 #=CP# CERTIFICATIONS Pace Project No.: Project: 92658989 7971 CONOVER Pace Analytical Services Charlotte South Carolina Laboratory ID: 99006 9800 Kincey Ave. Ste 100, Huntersville, NC 28078 North Carolina Drinking Water Certification #: 37706 North Carolina Field Services Certification #: 5342 North Carolina Wastewater Certification #: 12 South Carolina Laboratory ID: 99006 South Carolina Certification #: 99006001 South Carolina Drinking Water Cert. #: 99006003 Florida/NELAP Certification #: E87627 Kentucky UST Certification #: 84 Louisiana DoH Drinking Water #: LA029 Virginia/VELAP Certification #: 460221 Pace Analytical Services Asheville 2225 Riverside Drive, Asheville, NC 28804 Florida/NELAP Certification #: E87648 North Carolina Drinking Water Certification #: 37712 North Carolina Wastewater Certification #: 40 South Carolina Laboratory ID: 99030 South Carolina Certification #: 99030001 Virginia/VELAP Certification #: 460222 Pace Analytical Services Peachtree Corners 110 Technology Pkwy, Peachtree Corners, GA 30092 Florida DOH Certification #: E87315 Georgia DW Inorganics Certification #: 812 North Carolina Certification #: 381 South Carolina Certification #: 98011001 REPORT OF LABORATORY ANALYSIS This report shall not be reproduced, except in full, without the written consent of Pace Analytical Services, LLC. Pace Analytical Services, LLC 9800 Kincey Ave. Suite 100 Huntersville, NC 28078 (704)875-9092 Page 2 of 21 #=SS# SAMPLE SUMMARY Pace Project No.: Project: 92658989 7971 CONOVER Lab ID Sample ID Matrix Date Collected Date Received 92658989001 CONOVER EFFLUENT Water 03/27/23 11:30 03/27/23 12:55 92658989002 TRIP BLANK Water 03/27/23 00:00 03/27/23 12:55 REPORT OF LABORATORY ANALYSIS This report shall not be reproduced, except in full, without the written consent of Pace Analytical Services, LLC. Pace Analytical Services, LLC 9800 Kincey Ave. Suite 100 Huntersville, NC 28078 (704)875-9092 Page 3 of 21 #=SA# SAMPLE ANALYTE COUNT Pace Project No.: Project: 92658989 7971 CONOVER Lab ID Sample ID Method Analytes Reported LaboratoryAnalysts 92658989001 CONOVER EFFLUENT EPA 6020B 1 PASI-GACW1 EPA 8270E 4 PASI-CPKS SM 2540D-2015 1 PASI-AJMH1 92658989002 TRIP BLANK EPA 8260D 63 PASI-CCL PASI-A = Pace Analytical Services - Asheville PASI-C = Pace Analytical Services - Charlotte PASI-GA = Pace Analytical Services - Peachtree Corners, GA REPORT OF LABORATORY ANALYSIS This report shall not be reproduced, except in full, without the written consent of Pace Analytical Services, LLC. Pace Analytical Services, LLC 9800 Kincey Ave. Suite 100 Huntersville, NC 28078 (704)875-9092 Page 4 of 21 #=AR# ANALYTICAL RESULTS Pace Project No.: Project: 92658989 7971 CONOVER Sample:CONOVER EFFLUENT Lab ID:92658989001 Collected:03/27/23 11:30 Received:03/27/23 12:55 Matrix:Water Parameters Results Units DF Prepared Analyzed CAS No.QualMDLLimit Report Analytical Method: EPA 6020B Preparation Method: EPA 3005A Pace Analytical Services - Peachtree Corners, GA 6020 MET ICPMS Lead ND ug/L 03/31/23 16:57 7439-92-103/30/23 14:301.0 0.89 1 Analytical Method: EPA 8270E Preparation Method: EPA 3510C Pace Analytical Services - Charlotte 8270E RVE Phenol ND ug/L 04/01/23 02:15 108-95-203/31/23 15:509.1 1.2 1 Surrogates Phenol-d6 (S)56 %04/01/23 02:15 13127-88-303/31/23 15:5010-130 1 2-Fluorophenol (S)70 %04/01/23 02:15 367-12-403/31/23 15:5010-130 1 2,4,6-Tribromophenol (S)105 %04/01/23 02:15 118-79-603/31/23 15:5010-164 1 Analytical Method: SM 2540D-2015 Pace Analytical Services - Asheville 2540D Total Suspended Solids Total Suspended Solids ND mg/L 03/29/23 10:462.5 2.5 1 REPORT OF LABORATORY ANALYSIS This report shall not be reproduced, except in full, without the written consent of Pace Analytical Services, LLC.Date: 04/05/2023 04:33 PM Pace Analytical Services, LLC 9800 Kincey Ave. Suite 100 Huntersville, NC 28078 (704)875-9092 Page 5 of 21 #=AR# ANALYTICAL RESULTS Pace Project No.: Project: 92658989 7971 CONOVER Sample:TRIP BLANK Lab ID:92658989002 Collected:03/27/23 00:00 Received:03/27/23 12:55 Matrix:Water Parameters Results Units DF Prepared Analyzed CAS No.QualMDLLimit Report Analytical Method: EPA 8260D Pace Analytical Services - Charlotte 8260D MSV Low Level Acetone ND ug/L 03/28/23 16:04 67-64-125.0 5.1 1 Benzene ND ug/L 03/28/23 16:04 71-43-21.0 0.34 1 Bromobenzene ND ug/L 03/28/23 16:04 108-86-11.0 0.29 1 Bromochloromethane ND ug/L 03/28/23 16:04 74-97-51.0 0.47 1 Bromodichloromethane ND ug/L 03/28/23 16:04 75-27-41.0 0.31 1 Bromoform ND ug/L 03/28/23 16:04 75-25-21.0 0.34 1 Bromomethane ND ug/L 03/28/23 16:04 74-83-9 v22.0 1.7 1 2-Butanone (MEK)ND ug/L 03/28/23 16:04 78-93-35.0 4.0 1 Carbon tetrachloride ND ug/L 03/28/23 16:04 56-23-51.0 0.33 1 Chlorobenzene ND ug/L 03/28/23 16:04 108-90-71.0 0.28 1 Chloroethane ND ug/L 03/28/23 16:04 75-00-31.0 0.65 1 Chloroform ND ug/L 03/28/23 16:04 67-66-31.0 0.43 1 Chloromethane ND ug/L 03/28/23 16:04 74-87-31.0 0.54 1 2-Chlorotoluene ND ug/L 03/28/23 16:04 95-49-81.0 0.32 1 4-Chlorotoluene ND ug/L 03/28/23 16:04 106-43-41.0 0.32 1 1,2-Dibromo-3-chloropropane ND ug/L 03/28/23 16:04 96-12-82.0 0.34 1 Dibromochloromethane ND ug/L 03/28/23 16:04 124-48-11.0 0.36 1 1,2-Dibromoethane (EDB)ND ug/L 03/28/23 16:04 106-93-41.0 0.27 1 Dibromomethane ND ug/L 03/28/23 16:04 74-95-31.0 0.39 1 1,2-Dichlorobenzene ND ug/L 03/28/23 16:04 95-50-11.0 0.34 1 1,3-Dichlorobenzene ND ug/L 03/28/23 16:04 541-73-11.0 0.34 1 1,4-Dichlorobenzene ND ug/L 03/28/23 16:04 106-46-71.0 0.33 1 Dichlorodifluoromethane ND ug/L 03/28/23 16:04 75-71-81.0 0.35 1 1,1-Dichloroethane ND ug/L 03/28/23 16:04 75-34-31.0 0.37 1 1,2-Dichloroethane ND ug/L 03/28/23 16:04 107-06-21.0 0.32 1 1,1-Dichloroethene ND ug/L 03/28/23 16:04 75-35-41.0 0.35 1 cis-1,2-Dichloroethene ND ug/L 03/28/23 16:04 156-59-21.0 0.38 1 trans-1,2-Dichloroethene ND ug/L 03/28/23 16:04 156-60-51.0 0.40 1 1,2-Dichloropropane ND ug/L 03/28/23 16:04 78-87-51.0 0.36 1 1,3-Dichloropropane ND ug/L 03/28/23 16:04 142-28-91.0 0.28 1 2,2-Dichloropropane ND ug/L 03/28/23 16:04 594-20-7 v21.0 0.39 1 1,1-Dichloropropene ND ug/L 03/28/23 16:04 563-58-61.0 0.43 1 cis-1,3-Dichloropropene ND ug/L 03/28/23 16:04 10061-01-51.0 0.36 1 trans-1,3-Dichloropropene ND ug/L 03/28/23 16:04 10061-02-61.0 0.36 1 Diisopropyl ether ND ug/L 03/28/23 16:04 108-20-31.0 0.31 1 Ethylbenzene ND ug/L 03/28/23 16:04 100-41-41.0 0.30 1 Hexachloro-1,3-butadiene ND ug/L 03/28/23 16:04 87-68-32.0 1.5 1 2-Hexanone ND ug/L 03/28/23 16:04 591-78-65.0 0.48 1 p-Isopropyltoluene ND ug/L 03/28/23 16:04 99-87-61.0 0.41 1 Methylene Chloride ND ug/L 03/28/23 16:04 75-09-25.0 2.0 1 4-Methyl-2-pentanone (MIBK)ND ug/L 03/28/23 16:04 108-10-15.0 2.7 1 Methyl-tert-butyl ether ND ug/L 03/28/23 16:04 1634-04-41.0 0.42 1 Naphthalene ND ug/L 03/28/23 16:04 91-20-31.0 0.64 1 Styrene ND ug/L 03/28/23 16:04 100-42-51.0 0.29 1 1,1,1,2-Tetrachloroethane ND ug/L 03/28/23 16:04 630-20-61.0 0.31 1 REPORT OF LABORATORY ANALYSIS This report shall not be reproduced, except in full, without the written consent of Pace Analytical Services, LLC.Date: 04/05/2023 04:33 PM Pace Analytical Services, LLC 9800 Kincey Ave. Suite 100 Huntersville, NC 28078 (704)875-9092 Page 6 of 21 #=AR# ANALYTICAL RESULTS Pace Project No.: Project: 92658989 7971 CONOVER Sample:TRIP BLANK Lab ID:92658989002 Collected:03/27/23 00:00 Received:03/27/23 12:55 Matrix:Water Parameters Results Units DF Prepared Analyzed CAS No.QualMDLLimit Report Analytical Method: EPA 8260D Pace Analytical Services - Charlotte 8260D MSV Low Level 1,1,2,2-Tetrachloroethane ND ug/L 03/28/23 16:04 79-34-51.0 0.22 1 Tetrachloroethene ND ug/L 03/28/23 16:04 127-18-41.0 0.29 1 Toluene ND ug/L 03/28/23 16:04 108-88-31.0 0.24 1 1,2,3-Trichlorobenzene ND ug/L 03/28/23 16:04 87-61-61.0 0.81 1 1,2,4-Trichlorobenzene ND ug/L 03/28/23 16:04 120-82-11.0 0.64 1 1,1,1-Trichloroethane ND ug/L 03/28/23 16:04 71-55-61.0 0.33 1 1,1,2-Trichloroethane ND ug/L 03/28/23 16:04 79-00-51.0 0.32 1 Trichloroethene ND ug/L 03/28/23 16:04 79-01-61.0 0.38 1 Trichlorofluoromethane ND ug/L 03/28/23 16:04 75-69-41.0 0.30 1 1,2,3-Trichloropropane ND ug/L 03/28/23 16:04 96-18-41.0 0.26 1 Vinyl acetate ND ug/L 03/28/23 16:04 108-05-42.0 1.3 1 Vinyl chloride ND ug/L 03/28/23 16:04 75-01-41.0 0.39 1 Xylene (Total)ND ug/L 03/28/23 16:04 1330-20-71.0 0.34 1 m&p-Xylene ND ug/L 03/28/23 16:04 179601-23-12.0 0.71 1 o-Xylene ND ug/L 03/28/23 16:04 95-47-61.0 0.34 1 Surrogates 4-Bromofluorobenzene (S)96 %03/28/23 16:04 460-00-470-130 1 1,2-Dichloroethane-d4 (S)99 %03/28/23 16:04 17060-07-070-130 1 Toluene-d8 (S)99 %03/28/23 16:04 2037-26-570-130 1 REPORT OF LABORATORY ANALYSIS This report shall not be reproduced, except in full, without the written consent of Pace Analytical Services, LLC.Date: 04/05/2023 04:33 PM Pace Analytical Services, LLC 9800 Kincey Ave. Suite 100 Huntersville, NC 28078 (704)875-9092 Page 7 of 21 #=QC# QUALITY CONTROL DATA Pace Project No.: Project: 92658989 7971 CONOVER Results presented on this page are in the units indicated by the "Units" column except where an alternate unit is presented to the right of the result. QC Batch: QC Batch Method: Analysis Method: Analysis Description: 764930 EPA 3005A EPA 6020B 6020 MET Laboratory:Pace Analytical Services - Peachtree Corners, GA Associated Lab Samples:92658989001 Parameter Units Blank Result Reporting Limit Qualifiers METHOD BLANK:3971901 Associated Lab Samples:92658989001 Matrix:Water AnalyzedMDL Lead ug/L ND 1.0 03/31/23 14:480.89 Parameter Units LCS Result % Rec Limits Qualifiers% RecConc. 3971902LABORATORY CONTROL SAMPLE: LCSSpike Lead ug/L 100100 100 80-120 Parameter Units MS Result % Rec Limits Qual% RecConc. 3972021MATRIX SPIKE & MATRIX SPIKE DUPLICATE: MSSpike Result 92658210008 3972022 MSD Result MSD % Rec RPD RPD Max MSDMS Spike Conc. Lead ug/L 100 101 75-125100 1 20100ND10199.8 REPORT OF LABORATORY ANALYSIS This report shall not be reproduced, except in full, without the written consent of Pace Analytical Services, LLC.Date: 04/05/2023 04:33 PM Pace Analytical Services, LLC 9800 Kincey Ave. Suite 100 Huntersville, NC 28078 (704)875-9092 Page 8 of 21 #=QC# QUALITY CONTROL DATA Pace Project No.: Project: 92658989 7971 CONOVER Results presented on this page are in the units indicated by the "Units" column except where an alternate unit is presented to the right of the result. QC Batch: QC Batch Method: Analysis Method: Analysis Description: 764165 EPA 8260D EPA 8260D 8260D MSV Low Level Laboratory:Pace Analytical Services - Charlotte Associated Lab Samples:92658989002 Parameter Units Blank Result Reporting Limit Qualifiers METHOD BLANK:3968257 Associated Lab Samples:92658989002 Matrix:Water AnalyzedMDL 1,1,1,2-Tetrachloroethane ug/L ND 1.0 03/28/23 14:510.31 1,1,1-Trichloroethane ug/L ND 1.0 03/28/23 14:510.33 1,1,2,2-Tetrachloroethane ug/L ND 1.0 03/28/23 14:510.22 1,1,2-Trichloroethane ug/L ND 1.0 03/28/23 14:510.32 1,1-Dichloroethane ug/L ND 1.0 03/28/23 14:510.37 1,1-Dichloroethene ug/L ND 1.0 03/28/23 14:510.35 1,1-Dichloropropene ug/L ND 1.0 03/28/23 14:510.43 1,2,3-Trichlorobenzene ug/L ND 1.0 03/28/23 14:510.81 1,2,3-Trichloropropane ug/L ND 1.0 03/28/23 14:510.26 1,2,4-Trichlorobenzene ug/L ND 1.0 03/28/23 14:510.64 1,2-Dibromo-3-chloropropane ug/L ND 2.0 03/28/23 14:510.34 1,2-Dibromoethane (EDB)ug/L ND 1.0 03/28/23 14:510.27 1,2-Dichlorobenzene ug/L ND 1.0 03/28/23 14:510.34 1,2-Dichloroethane ug/L ND 1.0 03/28/23 14:510.32 1,2-Dichloropropane ug/L ND 1.0 03/28/23 14:510.36 1,3-Dichlorobenzene ug/L ND 1.0 03/28/23 14:510.34 1,3-Dichloropropane ug/L ND 1.0 03/28/23 14:510.28 1,4-Dichlorobenzene ug/L ND 1.0 03/28/23 14:510.33 2,2-Dichloropropane ug/L ND 1.0 v203/28/23 14:510.39 2-Butanone (MEK)ug/L ND 5.0 03/28/23 14:514.0 2-Chlorotoluene ug/L ND 1.0 03/28/23 14:510.32 2-Hexanone ug/L ND 5.0 03/28/23 14:510.48 4-Chlorotoluene ug/L ND 1.0 03/28/23 14:510.32 4-Methyl-2-pentanone (MIBK)ug/L ND 5.0 03/28/23 14:512.7 Acetone ug/L ND 25.0 03/28/23 14:515.1 Benzene ug/L ND 1.0 03/28/23 14:510.34 Bromobenzene ug/L ND 1.0 03/28/23 14:510.29 Bromochloromethane ug/L ND 1.0 03/28/23 14:510.47 Bromodichloromethane ug/L ND 1.0 03/28/23 14:510.31 Bromoform ug/L ND 1.0 03/28/23 14:510.34 Bromomethane ug/L ND 2.0 v203/28/23 14:511.7 Carbon tetrachloride ug/L ND 1.0 03/28/23 14:510.33 Chlorobenzene ug/L ND 1.0 03/28/23 14:510.28 Chloroethane ug/L ND 1.0 03/28/23 14:510.65 Chloroform ug/L ND 1.0 03/28/23 14:510.43 Chloromethane ug/L ND 1.0 03/28/23 14:510.54 cis-1,2-Dichloroethene ug/L ND 1.0 03/28/23 14:510.38 cis-1,3-Dichloropropene ug/L ND 1.0 03/28/23 14:510.36 Dibromochloromethane ug/L ND 1.0 03/28/23 14:510.36 Dibromomethane ug/L ND 1.0 03/28/23 14:510.39 REPORT OF LABORATORY ANALYSIS This report shall not be reproduced, except in full, without the written consent of Pace Analytical Services, LLC.Date: 04/05/2023 04:33 PM Pace Analytical Services, LLC 9800 Kincey Ave. Suite 100 Huntersville, NC 28078 (704)875-9092 Page 9 of 21 #=QC# QUALITY CONTROL DATA Pace Project No.: Project: 92658989 7971 CONOVER Results presented on this page are in the units indicated by the "Units" column except where an alternate unit is presented to the right of the result. Parameter Units Blank Result Reporting Limit Qualifiers METHOD BLANK:3968257 Associated Lab Samples:92658989002 Matrix:Water AnalyzedMDL Dichlorodifluoromethane ug/L ND 1.0 03/28/23 14:510.35 Diisopropyl ether ug/L ND 1.0 03/28/23 14:510.31 Ethylbenzene ug/L ND 1.0 03/28/23 14:510.30 Hexachloro-1,3-butadiene ug/L ND 2.0 03/28/23 14:511.5 m&p-Xylene ug/L ND 2.0 03/28/23 14:510.71 Methyl-tert-butyl ether ug/L ND 1.0 03/28/23 14:510.42 Methylene Chloride ug/L ND 5.0 03/28/23 14:512.0 Naphthalene ug/L ND 1.0 03/28/23 14:510.64 o-Xylene ug/L ND 1.0 03/28/23 14:510.34 p-Isopropyltoluene ug/L ND 1.0 03/28/23 14:510.41 Styrene ug/L ND 1.0 03/28/23 14:510.29 Tetrachloroethene ug/L ND 1.0 03/28/23 14:510.29 Toluene ug/L ND 1.0 03/28/23 14:510.24 trans-1,2-Dichloroethene ug/L ND 1.0 03/28/23 14:510.40 trans-1,3-Dichloropropene ug/L ND 1.0 03/28/23 14:510.36 Trichloroethene ug/L ND 1.0 03/28/23 14:510.38 Trichlorofluoromethane ug/L ND 1.0 03/28/23 14:510.30 Vinyl acetate ug/L ND 2.0 03/28/23 14:511.3 Vinyl chloride ug/L ND 1.0 03/28/23 14:510.39 Xylene (Total)ug/L ND 1.0 03/28/23 14:510.34 1,2-Dichloroethane-d4 (S)%98 70-130 03/28/23 14:51 4-Bromofluorobenzene (S)%97 70-130 03/28/23 14:51 Toluene-d8 (S)%99 70-130 03/28/23 14:51 Parameter Units LCS Result % Rec Limits Qualifiers% RecConc. 3968258LABORATORY CONTROL SAMPLE: LCSSpike 1,1,1,2-Tetrachloroethane ug/L 20.320 102 70-130 1,1,1-Trichloroethane ug/L 19.420 97 70-130 1,1,2,2-Tetrachloroethane ug/L 19.920 100 70-130 1,1,2-Trichloroethane ug/L 19.020 95 70-130 1,1-Dichloroethane ug/L 18.320 92 70-130 1,1-Dichloroethene ug/L 18.020 90 70-130 1,1-Dichloropropene ug/L 19.220 96 70-130 1,2,3-Trichlorobenzene ug/L 19.920 100 70-130 1,2,3-Trichloropropane ug/L 18.620 93 70-130 1,2,4-Trichlorobenzene ug/L 19.420 97 70-130 1,2-Dibromo-3-chloropropane ug/L 20.320 101 70-131 1,2-Dibromoethane (EDB)ug/L 19.620 98 70-130 1,2-Dichlorobenzene ug/L 19.720 98 70-130 1,2-Dichloroethane ug/L 18.220 91 70-130 1,2-Dichloropropane ug/L 18.520 93 70-130 1,3-Dichlorobenzene ug/L 19.520 98 70-130 1,3-Dichloropropane ug/L 19.120 95 70-130 REPORT OF LABORATORY ANALYSIS This report shall not be reproduced, except in full, without the written consent of Pace Analytical Services, LLC.Date: 04/05/2023 04:33 PM Pace Analytical Services, LLC 9800 Kincey Ave. Suite 100 Huntersville, NC 28078 (704)875-9092 Page 10 of 21 #=QC# QUALITY CONTROL DATA Pace Project No.: Project: 92658989 7971 CONOVER Results presented on this page are in the units indicated by the "Units" column except where an alternate unit is presented to the right of the result. Parameter Units LCS Result % Rec Limits Qualifiers% RecConc. 3968258LABORATORY CONTROL SAMPLE: LCSSpike 1,4-Dichlorobenzene ug/L 18.820 94 70-130 2,2-Dichloropropane ug/L 14.5 v3207368-135 2-Butanone (MEK)ug/L 33.240 83 70-134 2-Chlorotoluene ug/L 18.920 94 70-130 2-Hexanone ug/L 37.040 93 70-131 4-Chlorotoluene ug/L 18.920 94 70-130 4-Methyl-2-pentanone (MIBK)ug/L 35.740 89 70-130 Acetone ug/L 33.240 83 70-133 Benzene ug/L 18.720 94 70-130 Bromobenzene ug/L 19.720 98 70-130 Bromochloromethane ug/L 19.220 96 70-130 Bromodichloromethane ug/L 19.120 95 70-130 Bromoform ug/L 20.620 103 70-130 Bromomethane ug/L 14.4 v3207245-151 Carbon tetrachloride ug/L 20.620 103 70-130 Chlorobenzene ug/L 19.620 98 70-130 Chloroethane ug/L 18.420 92 39-152 Chloroform ug/L 18.620 93 70-130 Chloromethane ug/L 20.620 103 58-130 cis-1,2-Dichloroethene ug/L 18.120 90 70-130 cis-1,3-Dichloropropene ug/L 17.820 89 70-130 Dibromochloromethane ug/L 20.220 101 70-130 Dibromomethane ug/L 20.120 101 70-130 Dichlorodifluoromethane ug/L 23.120 115 54-133 Diisopropyl ether ug/L 16.720 84 70-130 Ethylbenzene ug/L 19.020 95 70-130 Hexachloro-1,3-butadiene ug/L 19.920 99 70-135 m&p-Xylene ug/L 38.240 96 70-130 Methyl-tert-butyl ether ug/L 17.320 86 70-130 Methylene Chloride ug/L 17.820 89 66-130 Naphthalene ug/L 19.920 99 70-130 o-Xylene ug/L 19.220 96 70-130 p-Isopropyltoluene ug/L 19.420 97 70-130 Styrene ug/L 19.920 99 70-130 Tetrachloroethene ug/L 19.420 97 70-130 Toluene ug/L 18.820 94 70-130 trans-1,2-Dichloroethene ug/L 18.420 92 70-130 trans-1,3-Dichloropropene ug/L 18.520 92 70-130 Trichloroethene ug/L 19.520 98 70-130 Trichlorofluoromethane ug/L 19.820 99 62-130 Vinyl acetate ug/L 34.640 87 70-144 Vinyl chloride ug/L 16.620 83 62-130 Xylene (Total)ug/L 57.460 96 70-130 1,2-Dichloroethane-d4 (S)%93 70-130 4-Bromofluorobenzene (S)%100 70-130 Toluene-d8 (S)%98 70-130 REPORT OF LABORATORY ANALYSIS This report shall not be reproduced, except in full, without the written consent of Pace Analytical Services, LLC.Date: 04/05/2023 04:33 PM Pace Analytical Services, LLC 9800 Kincey Ave. Suite 100 Huntersville, NC 28078 (704)875-9092 Page 11 of 21 #=QC# QUALITY CONTROL DATA Pace Project No.: Project: 92658989 7971 CONOVER Results presented on this page are in the units indicated by the "Units" column except where an alternate unit is presented to the right of the result. Parameter Units MS Result % Rec Limits Qual% RecConc. 3968259MATRIX SPIKE & MATRIX SPIKE DUPLICATE: MSSpike Result 92658924015 3968260 MSD Result MSD % Rec RPD RPD Max MSDMS Spike Conc. 1,1,1,2-Tetrachloroethane ug/L 20 99 70-141111 12 3020ND19.7 22.1 1,1,1-Trichloroethane ug/L 20 99 70-150116 16 3020ND19.8 23.1 1,1,2,2-Tetrachloroethane ug/L 20 102 69-142116 13 3020ND20.3 23.2 1,1,2-Trichloroethane ug/L 20 105 70-138109 4 3020ND21.0 21.8 1,1-Dichloroethane ug/L 20 91 70-150112 21 3020ND18.3 22.5 1,1-Dichloroethene ug/L 20 79 70-15692 16 3020ND15.7 18.4 1,1-Dichloropropene ug/L 20 103 70-150122 17 3020ND20.6 24.5 1,2,3-Trichlorobenzene ug/L 20 95 70-148117 20 3020ND19.0 23.3 1,2,3-Trichloropropane ug/L 20 98 70-140110 11 3020ND19.7 21.9 1,2,4-Trichlorobenzene ug/L 20 94 70-146118 22 3020ND18.9 23.6 1,2-Dibromo-3- chloropropane ug/L 20 96 68-146115 19 3020ND19.1 23.0 1,2-Dibromoethane (EDB)ug/L 20 101 70-138107 5 3020ND20.3 21.3 1,2-Dichlorobenzene ug/L 20 97 70-141117 18 3020ND19.4 23.3 1,2-Dichloroethane ug/L 20 96 69-143113 16 3020ND19.3 22.7 1,2-Dichloropropane ug/L 20 96 68-156114 17 3020ND19.3 22.9 1,3-Dichlorobenzene ug/L 20 99 70-143116 17 3020ND19.7 23.3 1,3-Dichloropropane ug/L 20 95 70-138102 7 3020ND19.1 20.4 1,4-Dichlorobenzene ug/L 20 99 70-142114 14 3020ND19.9 22.9 2,2-Dichloropropane ug/L 20 102 52-170118 15 3020ND20.4 23.6 2-Butanone (MEK)ug/L 40 99 60-157109 10 3040ND39.7 43.6 2-Chlorotoluene ug/L 20 98 70-147116 17 3020ND19.7 23.3 2-Hexanone ug/L 40 104 68-146114 9 3040ND41.4 45.4 4-Chlorotoluene ug/L 20 100 70-142119 17 3020ND20.1 23.8 4-Methyl-2-pentanone (MIBK)ug/L 40 104 70-141103 1 3040ND41.8 41.2 Acetone ug/L 40 80 58-15789 11 3040ND31.9 35.6 Benzene ug/L 20 96 70-142110 14 3020ND19.2 22.0 Bromobenzene ug/L 20 96 70-143113 16 3020ND19.3 22.7 Bromochloromethane ug/L 20 100 70-146117 16 3020ND19.9 23.3 Bromodichloromethane ug/L 20 91 70-139108 17 3020ND18.3 21.6 Bromoform ug/L 20 97 64-140110 13 3020ND19.3 22.0 Bromomethane ug/L 20 52 28-19263 20 3020ND10.4 12.6 Carbon tetrachloride ug/L 20 99 70-148109 9 3020ND19.8 21.7 Chlorobenzene ug/L 20 97 70-141113 15 3020ND19.4 22.5 Chloroethane ug/L 20 73 58-19185 15 3020ND14.6 16.9 Chloroform ug/L 20 99 70-148117 17 3020ND19.8 23.4 Chloromethane ug/L 20 50 43-16255 10 3020ND1011.0 cis-1,2-Dichloroethene ug/L 20 99 68-151115 13 30201.9 21.8 24.9 cis-1,3-Dichloropropene ug/L 20 101 70-139113 11 3020ND20.3 22.6 Dibromochloromethane ug/L 20 97 70-144107 10 3020ND19.3 21.4 Dibromomethane ug/L 20 94 70-139109 15 3020ND18.7 21.7 Dichlorodifluoromethane ug/L M1,v3203439-17138 11 3020ND6.8 7.6 Diisopropyl ether ug/L 20 83 67-142105 23 3020ND16.6 21.0 Ethylbenzene ug/L 20 98 70-143113 15 3020ND19.6 22.7 Hexachloro-1,3-butadiene ug/L 20 99 64-163122 21 3020ND19.8 24.5 REPORT OF LABORATORY ANALYSIS This report shall not be reproduced, except in full, without the written consent of Pace Analytical Services, LLC.Date: 04/05/2023 04:33 PM Pace Analytical Services, LLC 9800 Kincey Ave. Suite 100 Huntersville, NC 28078 (704)875-9092 Page 12 of 21 #=QC# QUALITY CONTROL DATA Pace Project No.: Project: 92658989 7971 CONOVER Results presented on this page are in the units indicated by the "Units" column except where an alternate unit is presented to the right of the result. Parameter Units MS Result % Rec Limits Qual% RecConc. 3968259MATRIX SPIKE & MATRIX SPIKE DUPLICATE: MSSpike Result 92658924015 3968260 MSD Result MSD % Rec RPD RPD Max MSDMS Spike Conc. m&p-Xylene ug/L 40 98 70-144113 14 3040ND39.1 45.1 Methyl-tert-butyl ether ug/L 20 80 65-14395 17 3020ND16.1 19.0 Methylene Chloride ug/L v1209562-149110 15 3020ND19.0 22.1 Naphthalene ug/L 20 98 67-147124 23 3020ND19.6 24.8 o-Xylene ug/L 20 100 70-145115 15 3020ND19.9 23.0 p-Isopropyltoluene ug/L 20 103 70-147122 17 3020ND20.7 24.5 Styrene ug/L 20 101 70-143117 15 3020ND20.3 23.4 Tetrachloroethene ug/L 20 96 70-145100 5 3020ND19.1 20.1 Toluene ug/L 20 100 70-142112 11 3020ND20.1 22.5 trans-1,2-Dichloroethene ug/L 20 89 70-151102 14 3020ND17.8 20.4 trans-1,3-Dichloropropene ug/L 20 102 70-139107 5 3020ND20.4 21.5 Trichloroethene ug/L 20 98 62-146114 15 3020ND19.6 22.7 Trichlorofluoromethane ug/L v3207563-15385 12 3020ND15.0 17.0 Vinyl acetate ug/L 40 93 61-162108 15 3040ND37.2 43.2 Vinyl chloride ug/L M1,v3204861-16354 10 30200.81J 10.5 11.6 Xylene (Total)ug/L 60 98 70-143114 14 3060ND59.0 68.2 1,2-Dichloroethane-d4 (S)%103 70-130102 4-Bromofluorobenzene (S)%101 70-130102 Toluene-d8 (S)%104 70-130101 REPORT OF LABORATORY ANALYSIS This report shall not be reproduced, except in full, without the written consent of Pace Analytical Services, LLC.Date: 04/05/2023 04:33 PM Pace Analytical Services, LLC 9800 Kincey Ave. Suite 100 Huntersville, NC 28078 (704)875-9092 Page 13 of 21 #=QC# QUALITY CONTROL DATA Pace Project No.: Project: 92658989 7971 CONOVER Results presented on this page are in the units indicated by the "Units" column except where an alternate unit is presented to the right of the result. QC Batch: QC Batch Method: Analysis Method: Analysis Description: 765090 EPA 3510C EPA 8270E 8270E Water MSSV RVE Laboratory:Pace Analytical Services - Charlotte Associated Lab Samples:92658989001 Parameter Units Blank Result Reporting Limit Qualifiers METHOD BLANK:3972715 Associated Lab Samples:92658989001 Matrix:Water AnalyzedMDL Phenol ug/L ND 10.0 03/31/23 21:071.4 2,4,6-Tribromophenol (S)%107 10-164 03/31/23 21:07 2-Fluorobiphenyl (S)%87 10-130 03/31/23 21:07 2-Fluorophenol (S)%68 10-130 03/31/23 21:07 Nitrobenzene-d5 (S)%92 10-138 03/31/23 21:07 Phenol-d6 (S)%56 10-130 03/31/23 21:07 Terphenyl-d14 (S)%106 19-191 03/31/23 21:07 Parameter Units LCS Result % Rec Limits Qualifiers% RecConc. 3972716LABORATORY CONTROL SAMPLE: LCSSpike Phenol ug/L 30.950 62 19-130 2,4,6-Tribromophenol (S)%129 10-164 2-Fluorobiphenyl (S)%97 10-130 2-Fluorophenol (S)%81 10-130 Nitrobenzene-d5 (S)%104 10-138 Phenol-d6 (S)%72 10-130 Terphenyl-d14 (S)%126 19-191 Parameter Units MS Result % Rec Limits Qual% RecConc. 3973193MATRIX SPIKE & MATRIX SPIKE DUPLICATE: MSSpike Result 92659368001 3973194 MSD Result MSD % Rec RPD RPD Max MSDMS Spike Conc. Phenol ug/L R1502110-13037 55 3050ND10.6 18.7 2,4,6-Tribromophenol (S)%14 10-16427 2-Fluorobiphenyl (S)%47 10-13087 2-Fluorophenol (S)%S0810-13017 Nitrobenzene-d5 (S)%50 10-13891 Phenol-d6 (S)%19 10-13033 Terphenyl-d14 (S)%81 19-19194 Parameter Units MS Result % Rec Limits Qual% RecConc. 3973964MATRIX SPIKE & MATRIX SPIKE DUPLICATE: MSSpike Result 92659546005 3973965 MSD Result MSD % Rec RPD RPD Max MSDMS Spike Conc. Phenol ug/L 100 56 10-13068 19 30100ND56.1 67.7 REPORT OF LABORATORY ANALYSIS This report shall not be reproduced, except in full, without the written consent of Pace Analytical Services, LLC.Date: 04/05/2023 04:33 PM Pace Analytical Services, LLC 9800 Kincey Ave. Suite 100 Huntersville, NC 28078 (704)875-9092 Page 14 of 21 #=QC# QUALITY CONTROL DATA Pace Project No.: Project: 92658989 7971 CONOVER Results presented on this page are in the units indicated by the "Units" column except where an alternate unit is presented to the right of the result. Parameter Units MS Result % Rec Limits Qual% RecConc. 3973964MATRIX SPIKE & MATRIX SPIKE DUPLICATE: MSSpike Result 92659546005 3973965 MSD Result MSD % Rec RPD RPD Max MSDMS Spike Conc. 2,4,6-Tribromophenol (S)%86 10-16491 2-Fluorobiphenyl (S)%79 10-13074 2-Fluorophenol (S)%63 10-13065 Nitrobenzene-d5 (S)%93 10-13890 Phenol-d6 (S)%51 10-13057 Terphenyl-d14 (S)%84 19-19186 REPORT OF LABORATORY ANALYSIS This report shall not be reproduced, except in full, without the written consent of Pace Analytical Services, LLC.Date: 04/05/2023 04:33 PM Pace Analytical Services, LLC 9800 Kincey Ave. Suite 100 Huntersville, NC 28078 (704)875-9092 Page 15 of 21 #=QC# QUALITY CONTROL DATA Pace Project No.: Project: 92658989 7971 CONOVER Results presented on this page are in the units indicated by the "Units" column except where an alternate unit is presented to the right of the result. QC Batch: QC Batch Method: Analysis Method: Analysis Description: 764530 SM 2540D-2015 SM 2540D-2015 2540D Total Suspended Solids Laboratory:Pace Analytical Services - Asheville Associated Lab Samples:92658989001 Parameter Units Blank Result Reporting Limit Qualifiers METHOD BLANK:3969944 Associated Lab Samples:92658989001 Matrix:Water AnalyzedMDL Total Suspended Solids mg/L ND 2.5 03/29/23 10:432.5 Parameter Units LCS Result % Rec Limits Qualifiers% RecConc. 3969945LABORATORY CONTROL SAMPLE: LCSSpike Total Suspended Solids mg/L 240250 96 90-110 Parameter Units Dup Result Max RPD QualifiersRPDResult 92658936001 3970016SAMPLE DUPLICATE: Total Suspended Solids mg/L 364 1 25362 Parameter Units Dup Result Max RPD QualifiersRPDResult 92659144001 3970017SAMPLE DUPLICATE: Total Suspended Solids mg/L 183 8 25169 REPORT OF LABORATORY ANALYSIS This report shall not be reproduced, except in full, without the written consent of Pace Analytical Services, LLC.Date: 04/05/2023 04:33 PM Pace Analytical Services, LLC 9800 Kincey Ave. Suite 100 Huntersville, NC 28078 (704)875-9092 Page 16 of 21 #=QL# QUALIFIERS Pace Project No.: Project: 92658989 7971 CONOVER DEFINITIONS DF - Dilution Factor, if reported, represents the factor applied to the reported data due to dilution of the sample aliquot. ND - Not Detected at or above adjusted reporting limit. TNTC - Too Numerous To Count J - Estimated concentration above the adjusted method detection limit and below the adjusted reporting limit. MDL - Adjusted Method Detection Limit. PQL - Practical Quantitation Limit. RL - Reporting Limit - The lowest concentration value that meets project requirements for quantitative data with known precision and bias for a specific analyte in a specific matrix. S - Surrogate 1,2-Diphenylhydrazine decomposes to and cannot be separated from Azobenzene using Method 8270. The result for each analyte is a combined concentration. Consistent with EPA guidelines, unrounded data are displayed and have been used to calculate % recovery and RPD values. LCS(D) - Laboratory Control Sample (Duplicate) MS(D) - Matrix Spike (Duplicate) DUP - Sample Duplicate RPD - Relative Percent Difference NC - Not Calculable. SG - Silica Gel - Clean-Up U - Indicates the compound was analyzed for, but not detected. Acid preservation may not be appropriate for 2 Chloroethylvinyl ether. A separate vial preserved to a pH of 4-5 is recommended in SW846 Chapter 4 for the analysis of Acrolein and Acrylonitrile by EPA Method 8260. N-Nitrosodiphenylamine decomposes and cannot be separated from Diphenylamine using Method 8270. The result reported for each analyte is a combined concentration. Reported results are not rounded until the final step prior to reporting. Therefore, calculated parameters that are typically reported as "Total" may vary slightly from the sum of the reported component parameters. Pace Analytical is TNI accredited. Contact your Pace PM for the current list of accredited analytes. TNI - The NELAC Institute. ANALYTE QUALIFIERS Matrix spike recovery exceeded QC limits. Batch accepted based on laboratory control sample (LCS) recovery.M1 RPD value was outside control limits.R1 Surrogate recovery outside laboratory control limits.S0 The continuing calibration verification was above the method acceptance limit. Any detection for the analyte in the associated samples may have a high bias.v1 The continuing calibration verification was below the method acceptance limit. The analyte was not detected in the associated samples and the sensitivity of the instrument was verified with a reporting limit check standard.v2 The continuing calibration verification was below the method acceptance limit. Any detection for the analyte in the associated samples may have low bias.v3 REPORT OF LABORATORY ANALYSIS This report shall not be reproduced, except in full, without the written consent of Pace Analytical Services, LLC.Date: 04/05/2023 04:33 PM Pace Analytical Services, LLC 9800 Kincey Ave. Suite 100 Huntersville, NC 28078 (704)875-9092 Page 17 of 21 #=CR# QUALITY CONTROL DATA CROSS REFERENCE TABLE Pace Project No.: Project: 92658989 7971 CONOVER Lab ID Sample ID QC Batch Method QC Batch Analytical Method Analytical Batch 92658989001 764930 765032CONOVER EFFLUENT EPA 3005A EPA 6020B 92658989001 765090 765320CONOVER EFFLUENT EPA 3510C EPA 8270E 92658989002 764165TRIP BLANK EPA 8260D 92658989001 764530CONOVER EFFLUENT SM 2540D-2015 REPORT OF LABORATORY ANALYSIS This report shall not be reproduced, except in full, without the written consent of Pace Analytical Services, LLC.Date: 04/05/2023 04:33 PM Pace Analytical Services, LLC 9800 Kincey Ave. Suite 100 Huntersville, NC 28078 (704)875-9092 Page 18 of 21 Page 19 of 21 Page 20 of 21 Page 21 of 21 #=CL# June 26, 2023 LIMS USE: FR - BRETT SCHAEFER LIMS OBJECT ID: 92673416 92673416 Project: Pace Project No.: RE: Brett Schaefer AECOM 6000 Fairview Rd Suite 200 Charlotte, NC 28210 Speedway 7971 CONOVER Dear Brett Schaefer: Enclosed are the analytical results for sample(s) received by the laboratory on June 20, 2023. The results relate only to the samples included in this report. Results reported herein conform to the applicable TNI/NELAC Standards and the laboratory's Quality Manual, where applicable, unless otherwise noted in the body of the report. The test results provided in this final report were generated by each of the following laboratories within the Pace Network: • Pace National - Mt. Juliet If you have any questions concerning this report, please feel free to contact me. Sincerely, Bonnie Vang bonnie.vang@pacelabs.com Project Manager (704)875-9092 Enclosures REPORT OF LABORATORY ANALYSIS This report shall not be reproduced, except in full, without the written consent of Pace Analytical Services, LLC. Pace Analytical Services, LLC 9800 Kincey Ave. Suite 100 Huntersville, NC 28078 (704)875-9092 Page 1 of 13 #=CP# CERTIFICATIONS Pace Project No.: Project: 92673416 Speedway 7971 CONOVER Pace Analytical Services National 12065 Lebanon Road, Mt. Juliet, TN 37122 Alabama Certification #: 40660 Alaska Certification 17-026 Arizona Certification #: AZ0612 Arkansas Certification #: 88-0469 California Certification #: 2932 Canada Certification #: 1461.01 Colorado Certification #: TN00003 Connecticut Certification #: PH-0197 DOD Certification: #1461.01 EPA# TN00003 Florida Certification #: E87487 Georgia DW Certification #: 923 Georgia Certification: NELAP Idaho Certification #: TN00003 Illinois Certification #: 200008 Indiana Certification #: C-TN-01 Iowa Certification #: 364 Kansas Certification #: E-10277 Kentucky UST Certification #: 16 Kentucky Certification #: 90010 Louisiana Certification #: AI30792 Louisiana DW Certification #: LA180010 Maine Certification #: TN0002 Maryland Certification #: 324 Massachusetts Certification #: M-TN003 Michigan Certification #: 9958 Minnesota Certification #: 047-999-395 Mississippi Certification #: TN00003 Missouri Certification #: 340 Montana Certification #: CERT0086 Nebraska Certification #: NE-OS-15-05 Nevada Certification #: TN-03-2002-34 New Hampshire Certification #: 2975 New Jersey Certification #: TN002 New Mexico DW Certification New York Certification #: 11742 North Carolina Aquatic Toxicity Certification #: 41 North Carolina Drinking Water Certification #: 21704 North Carolina Environmental Certificate #: 375 North Dakota Certification #: R-140 Ohio VAP Certification #: CL0069 Oklahoma Certification #: 9915 Oregon Certification #: TN200002 Pennsylvania Certification #: 68-02979 Rhode Island Certification #: LAO00356 South Carolina Certification #: 84004 South Dakota Certification Tennessee DW/Chem/Micro Certification #: 2006 Texas Certification #: T 104704245-17-14 Texas Mold Certification #: LAB0152 USDA Soil Permit #: P330-15-00234 Utah Certification #: TN00003 Virginia Certification #: VT2006 Vermont Dept. of Health: ID# VT-2006 Virginia Certification #: 460132 Washington Certification #: C847 West Virginia Certification #: 233 Wisconsin Certification #: 998093910 Wyoming UST Certification #: via A2LA 2926.01 A2LA-ISO 17025 Certification #: 1461.01 A2LA-ISO 17025 Certification #: 1461.02 AIHA-LAP/LLC EMLAP Certification #:100789 REPORT OF LABORATORY ANALYSIS This report shall not be reproduced, except in full, without the written consent of Pace Analytical Services, LLC. Pace Analytical Services, LLC 9800 Kincey Ave. Suite 100 Huntersville, NC 28078 (704)875-9092 Page 2 of 13 #=SS# SAMPLE SUMMARY Pace Project No.: Project: 92673416 Speedway 7971 CONOVER Lab ID Sample ID Matrix Date Collected Date Received 92673416001 CONOVER AIR STACK EFF Air 06/20/23 10:45 06/20/23 12:29 REPORT OF LABORATORY ANALYSIS This report shall not be reproduced, except in full, without the written consent of Pace Analytical Services, LLC. Pace Analytical Services, LLC 9800 Kincey Ave. Suite 100 Huntersville, NC 28078 (704)875-9092 Page 3 of 13 #=SA# SAMPLE ANALYTE COUNT Pace Project No.: Project: 92673416 Speedway 7971 CONOVER Lab ID Sample ID Method Analytes Reported LaboratoryAnalysts 92673416001 CONOVER AIR STACK EFF Method 18 Air MeOH & EtOH 6 PANAA, DAH PAN = Pace National - Mt. Juliet REPORT OF LABORATORY ANALYSIS This report shall not be reproduced, except in full, without the written consent of Pace Analytical Services, LLC. Pace Analytical Services, LLC 9800 Kincey Ave. Suite 100 Huntersville, NC 28078 (704)875-9092 Page 4 of 13 #=HO# SUMMARY OF DETECTION Pace Project No.: Project: 92673416 Speedway 7971 CONOVER Parameters AnalyzedResult Lab Sample ID Report Limit QualifiersUnitsMethod Client Sample ID 92673416001 CONOVER AIR STACK EFF Benzene 7220 ug/m3 06/23/23 04:4563.9Method 18 Air MeOH & EtOH Toluene 38400 ug/m3 06/23/23 19:48753Method 18 Air MeOH & EtOH Ethylbenzene 5770 ug/m3 06/23/23 04:4586.7Method 18 Air MeOH & EtOH m&p-Xylene 21900 ug/m3 06/23/23 04:45173Method 18 Air MeOH & EtOH o-Xylene 10300 ug/m3 06/23/23 04:4586.7Method 18 Air MeOH & EtOH REPORT OF LABORATORY ANALYSIS This report shall not be reproduced, except in full, without the written consent of Pace Analytical Services, LLC. Pace Analytical Services, LLC 9800 Kincey Ave. Suite 100 Huntersville, NC 28078 (704)875-9092 Page 5 of 13 #=AR# ANALYTICAL RESULTS Pace Project No.: Project: 92673416 Speedway 7971 CONOVER Sample:CONOVER AIR STACK EFF Lab ID:92673416001 Collected:06/20/23 10:45 Received:06/20/23 12:29 Matrix:Air Parameters Results Units DF Prepared Analyzed CAS No.QualMDLLimit Report Analytical Method: Method 18 Air MeOH & EtOH Preparation Method: M18-Mod Pace National - Mt. Juliet VOA (MS) M18-Mod Benzene 7220 ug/m3 06/23/23 04:45 71-43-206/23/23 04:4563.9 22.8 100 Toluene 38400 ug/m3 06/23/23 19:48 108-88-306/23/23 19:48753131400 Ethylbenzene 5770 ug/m3 06/23/23 04:45 100-41-406/23/23 04:4586.7 36.2 100 m&p-Xylene 21900 ug/m3 06/23/23 04:45 179601-23-106/23/23 04:4517358.5 100 o-Xylene 10300 ug/m3 06/23/23 04:45 95-47-606/23/23 04:4586.7 35.9 100 Surrogates 4-Bromofluorobenzene (S)106 %06/23/23 04:45 460-00-406/23/23 04:4560.0-140 100 4-Bromofluorobenzene (S)97.2 %06/23/23 19:48 460-00-406/23/23 19:4860.0-140 400 REPORT OF LABORATORY ANALYSIS This report shall not be reproduced, except in full, without the written consent of Pace Analytical Services, LLC.Date: 06/26/2023 11:10 AM Pace Analytical Services, LLC 9800 Kincey Ave. Suite 100 Huntersville, NC 28078 (704)875-9092 Page 6 of 13 #=QC# QUALITY CONTROL DATA Pace Project No.: Project: 92673416 Speedway 7971 CONOVER Results presented on this page are in the units indicated by the "Units" column except where an alternate unit is presented to the right of the result. QC Batch: QC Batch Method: Analysis Method: Analysis Description: 2082610 TO-15 Method 18 Air MeOH & EtOH VOA (MS) M18-Mod Laboratory:Pace National - Mt. Juliet Associated Lab Samples:92673416001 Parameter Units Blank Result Reporting Limit Qualifiers METHOD BLANK:R3940171-3 Associated Lab Samples:92673416001 Matrix:Air AnalyzedMDL Benzene ug/m3 ND 0.639 06/22/23 10:200.228 Ethylbenzene ug/m3 ND 0.867 06/22/23 10:200.362 m&p-Xylene ug/m3 ND 1.73 06/22/23 10:200.585 o-Xylene ug/m3 ND 0.867 06/22/23 10:200.359 4-Bromofluorobenzene (S)%95.9 60.0-140 06/22/23 10:20 Parameter Units LCS Result % Rec Limits Qualifiers% RecConc. R3940171-1LABORATORY CONTROL SAMPLE & LCSD: LCSSpike LCSD % Rec RPD Max RPD LCSD Result R3940171-2 Benzene ug/m3 12.612.0 105 70.0-13010612.7 1.01 25 Ethylbenzene ug/m3 17.716.3 109 70.0-13011017.9 1.46 25 m&p-Xylene ug/m3 36.632.5 113 70.0-13011537.3 1.76 25 o-Xylene ug/m3 18.216.3 112 70.0-13011418.5 1.42 25 4-Bromofluorobenzene (S)%102 60.0-140102 REPORT OF LABORATORY ANALYSIS This report shall not be reproduced, except in full, without the written consent of Pace Analytical Services, LLC.Date: 06/26/2023 11:10 AM Pace Analytical Services, LLC 9800 Kincey Ave. Suite 100 Huntersville, NC 28078 (704)875-9092 Page 7 of 13 #=QC# QUALITY CONTROL DATA Pace Project No.: Project: 92673416 Speedway 7971 CONOVER Results presented on this page are in the units indicated by the "Units" column except where an alternate unit is presented to the right of the result. QC Batch: QC Batch Method: Analysis Method: Analysis Description: 2083273 TO-15 Method 18 Air MeOH & EtOH VOA (MS) M18-Mod Laboratory:Pace National - Mt. Juliet Associated Lab Samples:92673416001 Parameter Units Blank Result Reporting Limit Qualifiers METHOD BLANK:R3940558-3 Associated Lab Samples:92673416001 Matrix:Air AnalyzedMDL Toluene ug/m3 ND 1.88 06/23/23 09:230.328 4-Bromofluorobenzene (S)%92 60.0-140 06/23/23 09:23 Parameter Units LCS Result % Rec Limits Qualifiers% RecConc. R3940558-1LABORATORY CONTROL SAMPLE & LCSD: LCSSpike LCSD % Rec RPD Max RPD LCSD Result R3940558-2 Toluene ug/m3 14.814.1 105 70.0-13010615.0 1.01 25 4-Bromofluorobenzene (S)%101 60.0-14098.0 REPORT OF LABORATORY ANALYSIS This report shall not be reproduced, except in full, without the written consent of Pace Analytical Services, LLC.Date: 06/26/2023 11:10 AM Pace Analytical Services, LLC 9800 Kincey Ave. Suite 100 Huntersville, NC 28078 (704)875-9092 Page 8 of 13 #=QL# QUALIFIERS Pace Project No.: Project: 92673416 Speedway 7971 CONOVER DEFINITIONS DF - Dilution Factor, if reported, represents the factor applied to the reported data due to dilution of the sample aliquot. ND - Not Detected at or above adjusted reporting limit. TNTC - Too Numerous To Count J - Estimated concentration above the adjusted method detection limit and below the adjusted reporting limit. MDL - Adjusted Method Detection Limit. PQL - Practical Quantitation Limit. RL - Reporting Limit - The lowest concentration value that meets project requirements for quantitative data with known precision and bias for a specific analyte in a specific matrix. S - Surrogate 1,2-Diphenylhydrazine decomposes to and cannot be separated from Azobenzene using Method 8270. The result for each analyte is a combined concentration. Consistent with EPA guidelines, unrounded data are displayed and have been used to calculate % recovery and RPD values. LCS(D) - Laboratory Control Sample (Duplicate) MS(D) - Matrix Spike (Duplicate) DUP - Sample Duplicate RPD - Relative Percent Difference NC - Not Calculable. SG - Silica Gel - Clean-Up U - Indicates the compound was analyzed for, but not detected. Acid preservation may not be appropriate for 2 Chloroethylvinyl ether. A separate vial preserved to a pH of 4-5 is recommended in SW846 Chapter 4 for the analysis of Acrolein and Acrylonitrile by EPA Method 8260. N-Nitrosodiphenylamine decomposes and cannot be separated from Diphenylamine using Method 8270. The result reported for each analyte is a combined concentration. Reported results are not rounded until the final step prior to reporting. Therefore, calculated parameters that are typically reported as "Total" may vary slightly from the sum of the reported component parameters. Pace Analytical is TNI accredited. Contact your Pace PM for the current list of accredited analytes. TNI - The NELAC Institute. REPORT OF LABORATORY ANALYSIS This report shall not be reproduced, except in full, without the written consent of Pace Analytical Services, LLC.Date: 06/26/2023 11:10 AM Pace Analytical Services, LLC 9800 Kincey Ave. Suite 100 Huntersville, NC 28078 (704)875-9092 Page 9 of 13 #=CR# QUALITY CONTROL DATA CROSS REFERENCE TABLE Pace Project No.: Project: 92673416 Speedway 7971 CONOVER Lab ID Sample ID QC Batch Method QC Batch Analytical Method Analytical Batch 92673416001 2082610 2082610CONOVER AIR STACK EFF M18-Mod Method 18 Air MeOH &EtOH 92673416001 2083273 2083273CONOVER AIR STACK EFF M18-Mod Method 18 Air MeOH & EtOH REPORT OF LABORATORY ANALYSIS This report shall not be reproduced, except in full, without the written consent of Pace Analytical Services, LLC.Date: 06/26/2023 11:10 AM Pace Analytical Services, LLC 9800 Kincey Ave. Suite 100 Huntersville, NC 28078 (704)875-9092 Page 10 of 13 Page 11 of 13 Page 12 of 13 Page 13 of 13 #=CL# June 26, 2023 LIMS USE: FR - BRETT SCHAEFER LIMS OBJECT ID: 92673422 92673422 Project: Pace Project No.: RE: Brett Schaefer AECOM 6000 Fairview Rd Suite 200 Charlotte, NC 28210 Speedway 7971 CONOVER Dear Brett Schaefer: Enclosed are the analytical results for sample(s) received by the laboratory on June 20, 2023. The results relate only to the samples included in this report. Results reported herein conform to the applicable TNI/NELAC Standards and the laboratory's Quality Manual, where applicable, unless otherwise noted in the body of the report. The test results provided in this final report were generated by each of the following laboratories within the Pace Network: • Pace Analytical Services - Asheville • Pace Analytical Services - Charlotte If you have any questions concerning this report, please feel free to contact me. Sincerely, Bonnie Vang bonnie.vang@pacelabs.com Project Manager (704)875-9092 Enclosures REPORT OF LABORATORY ANALYSIS This report shall not be reproduced, except in full, without the written consent of Pace Analytical Services, LLC. Pace Analytical Services, LLC 9800 Kincey Ave. Suite 100 Huntersville, NC 28078 (704)875-9092 Page 1 of 14 #=CP# CERTIFICATIONS Pace Project No.: Project: 92673422 Speedway 7971 CONOVER Pace Analytical Services Charlotte South Carolina Laboratory ID: 99006 9800 Kincey Ave. Ste 100, Huntersville, NC 28078 North Carolina Drinking Water Certification #: 37706 North Carolina Field Services Certification #: 5342 North Carolina Wastewater Certification #: 12 South Carolina Laboratory ID: 99006 South Carolina Certification #: 99006001 South Carolina Drinking Water Cert. #: 99006003 Florida/NELAP Certification #: E87627 Kentucky UST Certification #: 84 Louisiana DoH Drinking Water #: LA029 Virginia/VELAP Certification #: 460221 Pace Analytical Services Asheville 2225 Riverside Drive, Asheville, NC 28804 Florida/NELAP Certification #: E87648 North Carolina Drinking Water Certification #: 37712 North Carolina Wastewater Certification #: 40 South Carolina Laboratory ID: 99030 South Carolina Certification #: 99030001 Virginia/VELAP Certification #: 460222 REPORT OF LABORATORY ANALYSIS This report shall not be reproduced, except in full, without the written consent of Pace Analytical Services, LLC. Pace Analytical Services, LLC 9800 Kincey Ave. Suite 100 Huntersville, NC 28078 (704)875-9092 Page 2 of 14 #=SS# SAMPLE SUMMARY Pace Project No.: Project: 92673422 Speedway 7971 CONOVER Lab ID Sample ID Matrix Date Collected Date Received 92673422001 CONOVER EFFLUENT Water 06/20/23 10:20 06/20/23 12:29 REPORT OF LABORATORY ANALYSIS This report shall not be reproduced, except in full, without the written consent of Pace Analytical Services, LLC. Pace Analytical Services, LLC 9800 Kincey Ave. Suite 100 Huntersville, NC 28078 (704)875-9092 Page 3 of 14 #=SA# SAMPLE ANALYTE COUNT Pace Project No.: Project: 92673422 Speedway 7971 CONOVER Lab ID Sample ID Method Analytes Reported LaboratoryAnalysts 92673422001 CONOVER EFFLUENT EPA 6010D 1 PASI-ADBB1 EPA 8270E 4 PASI-CPKS SM 2540D-2015 1 PASI-AMAB2 PASI-A = Pace Analytical Services - Asheville PASI-C = Pace Analytical Services - Charlotte REPORT OF LABORATORY ANALYSIS This report shall not be reproduced, except in full, without the written consent of Pace Analytical Services, LLC. Pace Analytical Services, LLC 9800 Kincey Ave. Suite 100 Huntersville, NC 28078 (704)875-9092 Page 4 of 14 #=HO# SUMMARY OF DETECTION Pace Project No.: Project: 92673422 Speedway 7971 CONOVER Parameters AnalyzedResult Lab Sample ID Report Limit QualifiersUnitsMethod Client Sample ID 92673422001 CONOVER EFFLUENT Total Suspended Solids 2.5 mg/L 06/23/23 14:402.5SM 2540D-2015 REPORT OF LABORATORY ANALYSIS This report shall not be reproduced, except in full, without the written consent of Pace Analytical Services, LLC. Pace Analytical Services, LLC 9800 Kincey Ave. Suite 100 Huntersville, NC 28078 (704)875-9092 Page 5 of 14 #=AR# ANALYTICAL RESULTS Pace Project No.: Project: 92673422 Speedway 7971 CONOVER Sample:CONOVER EFFLUENT Lab ID:92673422001 Collected:06/20/23 10:20 Received:06/20/23 12:29 Matrix:Water Parameters Results Units DF Prepared Analyzed CAS No.QualMDLLimit Report Analytical Method: EPA 6010D Preparation Method: EPA 3010A Pace Analytical Services - Asheville 6010 MET ICP Lead ND ug/L 06/22/23 14:40 7439-92-106/21/23 10:505.0 4.5 1 Analytical Method: EPA 8270E Preparation Method: EPA 3510C Pace Analytical Services - Charlotte 8270E RVE Phenol ND ug/L 06/24/23 15:48 108-95-206/22/23 16:228.7 1.2 1 Surrogates Phenol-d6 (S)36 %06/24/23 15:48 13127-88-306/22/23 16:2210-130 1 2-Fluorophenol (S)48 %06/24/23 15:48 367-12-406/22/23 16:2210-130 1 2,4,6-Tribromophenol (S)84 %06/24/23 15:48 118-79-606/22/23 16:2210-164 1 Analytical Method: SM 2540D-2015 Pace Analytical Services - Asheville 2540D Total Suspended Solids Total Suspended Solids 2.5 mg/L 06/23/23 14:402.5 2.5 1 REPORT OF LABORATORY ANALYSIS This report shall not be reproduced, except in full, without the written consent of Pace Analytical Services, LLC.Date: 06/26/2023 01:07 PM Pace Analytical Services, LLC 9800 Kincey Ave. Suite 100 Huntersville, NC 28078 (704)875-9092 Page 6 of 14 #=QC# QUALITY CONTROL DATA Pace Project No.: Project: 92673422 Speedway 7971 CONOVER Results presented on this page are in the units indicated by the "Units" column except where an alternate unit is presented to the right of the result. QC Batch: QC Batch Method: Analysis Method: Analysis Description: 781913 EPA 3010A EPA 6010D 6010 MET Laboratory:Pace Analytical Services - Asheville Associated Lab Samples:92673422001 Parameter Units Blank Result Reporting Limit Qualifiers METHOD BLANK:4056224 Associated Lab Samples:92673422001 Matrix:Water AnalyzedMDL Lead ug/L ND 5.0 06/22/23 13:534.5 Parameter Units LCS Result % Rec Limits Qualifiers% RecConc. 4056225LABORATORY CONTROL SAMPLE: LCSSpike Lead ug/L 526500 105 80-120 Parameter Units MS Result % Rec Limits Qual% RecConc. 4056226MATRIX SPIKE & MATRIX SPIKE DUPLICATE: MSSpike Result 92673295001 4056227 MSD Result MSD % Rec RPD RPD Max MSDMS Spike Conc. Lead ug/L 500 93 75-12596 3 205000.012 mg/L 479 493 REPORT OF LABORATORY ANALYSIS This report shall not be reproduced, except in full, without the written consent of Pace Analytical Services, LLC.Date: 06/26/2023 01:07 PM Pace Analytical Services, LLC 9800 Kincey Ave. Suite 100 Huntersville, NC 28078 (704)875-9092 Page 7 of 14 #=QC# QUALITY CONTROL DATA Pace Project No.: Project: 92673422 Speedway 7971 CONOVER Results presented on this page are in the units indicated by the "Units" column except where an alternate unit is presented to the right of the result. QC Batch: QC Batch Method: Analysis Method: Analysis Description: 782338 EPA 3510C EPA 8270E 8270E Water MSSV RVE Laboratory:Pace Analytical Services - Charlotte Associated Lab Samples:92673422001 Parameter Units Blank Result Reporting Limit Qualifiers METHOD BLANK:4058250 Associated Lab Samples:92673422001 Matrix:Water AnalyzedMDL Phenol ug/L ND 10.0 06/23/23 10:431.4 2,4,6-Tribromophenol (S)%56 10-164 06/23/23 10:43 2-Fluorobiphenyl (S)%42 10-130 06/23/23 10:43 2-Fluorophenol (S)%37 10-130 06/23/23 10:43 Nitrobenzene-d5 (S)%46 10-138 06/23/23 10:43 Phenol-d6 (S)%30 10-130 06/23/23 10:43 Terphenyl-d14 (S)%58 19-191 06/23/23 10:43 Parameter Units LCS Result % Rec Limits Qualifiers% RecConc. 4058251LABORATORY CONTROL SAMPLE: LCSSpike Phenol ug/L 33.750 67 19-130 2,4,6-Tribromophenol (S)%100 10-164 2-Fluorobiphenyl (S)%85 10-130 2-Fluorophenol (S)%64 10-130 Nitrobenzene-d5 (S)%77 10-138 Phenol-d6 (S)%52 10-130 Terphenyl-d14 (S)%93 19-191 Parameter Units MS Result % Rec Limits Qual% RecConc. 4058252MATRIX SPIKE & MATRIX SPIKE DUPLICATE: MSSpike Result 35806987005 4058253 MSD Result MSD % Rec RPD RPD Max MSDMS Spike Conc. Phenol ug/L 83.3 32 10-13031 3083.35.6U 26.4J 25.7J 2,4,6-Tribromophenol (S)%13 10-16425 2-Fluorobiphenyl (S)%64 10-13039 2-Fluorophenol (S)%12 10-13017 Nitrobenzene-d5 (S)%D36110-13838 Phenol-d6 (S)%27 10-13022 Terphenyl-d14 (S)%72 19-19141 REPORT OF LABORATORY ANALYSIS This report shall not be reproduced, except in full, without the written consent of Pace Analytical Services, LLC.Date: 06/26/2023 01:07 PM Pace Analytical Services, LLC 9800 Kincey Ave. Suite 100 Huntersville, NC 28078 (704)875-9092 Page 8 of 14 #=QC# QUALITY CONTROL DATA Pace Project No.: Project: 92673422 Speedway 7971 CONOVER Results presented on this page are in the units indicated by the "Units" column except where an alternate unit is presented to the right of the result. QC Batch: QC Batch Method: Analysis Method: Analysis Description: 782587 SM 2540D-2015 SM 2540D-2015 2540D Total Suspended Solids Laboratory:Pace Analytical Services - Asheville Associated Lab Samples:92673422001 Parameter Units Blank Result Reporting Limit Qualifiers METHOD BLANK:4059452 Associated Lab Samples:92673422001 Matrix:Water AnalyzedMDL Total Suspended Solids mg/L ND 2.5 06/23/23 14:332.5 Parameter Units LCS Result % Rec Limits Qualifiers% RecConc. 4059453LABORATORY CONTROL SAMPLE & LCSD: LCSSpike LCSD % Rec RPD Max RPD LCSD Result 4060095 Total Suspended Solids mg/L 240250 96 90-11091226 6 25 Parameter Units Dup Result Max RPD QualifiersRPDResult 92673429001 4060096SAMPLE DUPLICATE: Total Suspended Solids mg/L 49.3 3 2548.0 REPORT OF LABORATORY ANALYSIS This report shall not be reproduced, except in full, without the written consent of Pace Analytical Services, LLC.Date: 06/26/2023 01:07 PM Pace Analytical Services, LLC 9800 Kincey Ave. Suite 100 Huntersville, NC 28078 (704)875-9092 Page 9 of 14 #=QL# QUALIFIERS Pace Project No.: Project: 92673422 Speedway 7971 CONOVER DEFINITIONS DF - Dilution Factor, if reported, represents the factor applied to the reported data due to dilution of the sample aliquot. ND - Not Detected at or above adjusted reporting limit. TNTC - Too Numerous To Count J - Estimated concentration above the adjusted method detection limit and below the adjusted reporting limit. MDL - Adjusted Method Detection Limit. PQL - Practical Quantitation Limit. RL - Reporting Limit - The lowest concentration value that meets project requirements for quantitative data with known precision and bias for a specific analyte in a specific matrix. S - Surrogate 1,2-Diphenylhydrazine decomposes to and cannot be separated from Azobenzene using Method 8270. The result for each analyte is a combined concentration. Consistent with EPA guidelines, unrounded data are displayed and have been used to calculate % recovery and RPD values. LCS(D) - Laboratory Control Sample (Duplicate) MS(D) - Matrix Spike (Duplicate) DUP - Sample Duplicate RPD - Relative Percent Difference NC - Not Calculable. SG - Silica Gel - Clean-Up U - Indicates the compound was analyzed for, but not detected. Acid preservation may not be appropriate for 2 Chloroethylvinyl ether. A separate vial preserved to a pH of 4-5 is recommended in SW846 Chapter 4 for the analysis of Acrolein and Acrylonitrile by EPA Method 8260. N-Nitrosodiphenylamine decomposes and cannot be separated from Diphenylamine using Method 8270. The result reported for each analyte is a combined concentration. Reported results are not rounded until the final step prior to reporting. Therefore, calculated parameters that are typically reported as "Total" may vary slightly from the sum of the reported component parameters. Pace Analytical is TNI accredited. Contact your Pace PM for the current list of accredited analytes. TNI - The NELAC Institute. ANALYTE QUALIFIERS Sample was diluted due to the presence of high levels of non-target analytes or other matrix interference.D3 REPORT OF LABORATORY ANALYSIS This report shall not be reproduced, except in full, without the written consent of Pace Analytical Services, LLC.Date: 06/26/2023 01:07 PM Pace Analytical Services, LLC 9800 Kincey Ave. Suite 100 Huntersville, NC 28078 (704)875-9092 Page 10 of 14 #=CR# QUALITY CONTROL DATA CROSS REFERENCE TABLE Pace Project No.: Project: 92673422 Speedway 7971 CONOVER Lab ID Sample ID QC Batch Method QC Batch Analytical Method Analytical Batch 92673422001 781913 782012CONOVER EFFLUENT EPA 3010A EPA 6010D 92673422001 782338 782473CONOVER EFFLUENT EPA 3510C EPA 8270E 92673422001 782587CONOVER EFFLUENT SM 2540D-2015 REPORT OF LABORATORY ANALYSIS This report shall not be reproduced, except in full, without the written consent of Pace Analytical Services, LLC.Date: 06/26/2023 01:07 PM Pace Analytical Services, LLC 9800 Kincey Ave. Suite 100 Huntersville, NC 28078 (704)875-9092 Page 11 of 14 Page 12 of 14 Page 13 of 14 Page 14 of 14